(data stored in ACNUC7421 zone)

EMBL: CP000478.PE315

CP000478.PE315       Location/Qualifiers
FT   CDS_pept        381120..381737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0318"
FT                   /product="gliding motility protein (MglA)"
FT                   /note="KEGG: dps:DP2776 gliding motility protein (MglA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16019"
FT                   /db_xref="GOA:A0LF17"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF17"
FT                   /protein_id="ABK16019.1"
FT                   /translation="MAFIDLNKNEIQAKIVYYGPGRGGKTTNLLFIHESMSKQVCGKMV
FT                   TIDTKGDRTLFFDFLPLSIGKILNLSIRIQLYTVPGQVMYNTTRKLVLRGVDGVAFVAD
FT                   SLRVQKQKNVESLLNLAENLTDEGLDIHDIPLVLQYNKRDLMESNIPLLSVEEMQEDLN
FT                   KDLKVPAFEASAMRGNGVYETLREISKRTIKNVIQKVGGDLK"
     gtggccttta tagaccttaa caagaacgaa attcaagcca agatcgtcta ctatggtccg        60
     ggtcgaggag gcaagaccac gaatctgctt ttcattcacg aatcgatgtc caagcaggtt       120
     tgcggcaaga tggtcacgat cgacacgaag ggcgaccgta ctctcttctt tgatttcctg       180
     cccctgagca tcggcaagat cctgaacctg agcatccgca tccagttgta cacggttccg       240
     ggtcaggtca tgtacaacac cacgagaaag ctggttctgc gaggggttga cggagttgcc       300
     ttcgtggcgg attcgttgcg cgttcagaag caaaagaacg tggagagcct cctgaacctt       360
     gccgaaaacc tgacggacga aggtctcgac attcacgata tccccctcgt tctccagtac       420
     aacaaacgcg acctcatgga atccaacatt cctctcctct ctgttgaaga gatgcaggaa       480
     gacctgaaca aggacctgaa agttccggcc ttcgaggcaa gcgccatgag ggggaacggg       540
     gtttatgaga ctttgaggga aatcagcaag cgcaccataa agaacgtgat ccagaaagtg       600
     ggcggagatt taaagtag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page