(data stored in ACNUC7421 zone)

EMBL: CP000478.PE316

CP000478.PE316       Location/Qualifiers
FT   CDS_pept        382084..384603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ani:AN5649.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16020"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF18"
FT                   /protein_id="ABK16020.1"
FT                   /translation="MSEKQNDDAAEKKRKIDFDAFELQIDQEIDSLFIPAGQTAQDAGS
FT                   SAAIGKEAQPAPPRPAPATSPKVAPEIVAGIAPEMVPKLTVEPVPETAPKPAATSLSGI
FT                   APERLSKPDVEPVPEISLETAFKAVGPAVAEKVPEIPAQTVPKVVPDLPESAEGFHRMT
FT                   ELQPEAAAPVAGGGELEVEIDREIDLLFQAETAASPKSEPTAAQSRPVPDILATGKIKT
FT                   EDIMEEPVFEPLKAEAPPATPSSPVKPVEIKSGDFELQLDQEIDSLFVPSSPIPPAPSA
FT                   KTPTAEFQFEIPGAEAKAEEPPAPRVAAEQPAPKAPQVDLLADLNLEEILSAEPHKPAS
FT                   DLFRAAPEKAEPAPTAVMPAPDWFKPVSDAPAVTPAPVLDEVRAEKAETAPAAELEAEE
FT                   GTELAALLDAFKIAYLSLDWEFSVENISSLQASLSSLEPHCRKSAGANSIYKILKAVLE
FT                   RLKTKPHAINPQLIEMVRDSQELLKPILLKEGHLDRQEKEKVKNLIARFQTQRDKTSLD
FT                   KAPITSRLATEADAGMEVDQAVPLATLPEDQIAFVDRRPISALKGWLEASRALVSETVQ
FT                   GLEFENRRLRQIEQILGKTKALEPLVARLEGIRANVEKHVLAFKSREPEWDERIRWLGE
FT                   LDVTISSRGGQVPRPAEDAVELEEVVLEAEELREPGYAPAFSVEGDVRPDQVYYFSMGG
FT                   RKFAVLASQVVKIDKVSGAKVKKFVKQGYASLNDFKPMFKNIKAGLFGTWGGLPLEVLK
FT                   GYRFVPIPAEVFGGESLPARSGGAILLSSGKRHGIVFCDSAVVDLHNDVEIVIGKASDD
FT                   RMLGSIMGVADAPVEVLNLDRTVRSLG"
     atgtccgaaa aacaaaatga tgatgcagca gaaaaaaaga ggaagatcga ttttgacgca        60
     tttgaactgc agatagatca ggagatcgac agcctgttca ttcctgccgg tcagactgcg       120
     caggatgcgg gctcatctgc ggcgatcggg aaggaagcgc aacctgcgcc gccccggccg       180
     gctcccgcga cttcccccaa ggtggctccc gagatcgttg ccgggattgc acccgagatg       240
     gtaccgaagc tgaccgtcga acccgttccc gagacggcgc cgaagcctgc cgccacatcg       300
     ctttccggga ttgcgcccga gaggttgtcg aagccggatg tcgagcccgt tcccgagatc       360
     tcgcttgaaa ccgcattcaa ggcggttggt cccgccgttg ccgagaaggt gccggagatt       420
     ccggcccaaa cggtccccaa ggtcgttccc gaccttccgg agtcggctga aggctttcac       480
     aggatgacgg aactgcaacc cgaggccgcg gcgccggtcg ccggaggggg tgagctggaa       540
     gtcgagatcg accgggaaat cgatctcctg ttccaggccg agaccgctgc gtcaccgaag       600
     tccgagccga cggcggccca gagccggcct gttccggata tccttgccac cgggaagatc       660
     aagaccgagg acatcatgga ggaacccgtt ttcgagcctc tgaaagccga ggcgcctccc       720
     gcgactcctt cttctcccgt caaacccgtg gaaatcaagt ccggcgactt tgaattgcag       780
     ctcgaccagg aaatcgacag tctcttcgtg ccgtcgagtc cgattccgcc cgcgccttcg       840
     gcaaaaaccc cgacagccga attccagttc gagatccccg gggcggaagc gaaggccgag       900
     gaaccgcccg ctcctcgcgt cgctgcggag caacccgcac ccaaggcgcc gcaagtggat       960
     cttctcgccg acctcaatct cgaagagata ctgtccgccg aaccgcacaa gccggcttcc      1020
     gatctgttca gagcggctcc ggagaaggct gagcctgctc ccacagcggt gatgccggct      1080
     cccgactggt ttaagccggt ttccgacgcg cctgccgtca ctccggcacc ggtattggat      1140
     gaagtgcggg ccgagaaggc ggaaacggcg ccggccgcgg agctggaagc cgaggaagga      1200
     acggagctcg ccgccctgct ggatgcgttc aaaatcgcat acctcagcct ggattgggaa      1260
     ttctccgtcg agaacatctc cagcctccag gcctccctga gcagcctcga gccccattgc      1320
     cgcaagagcg caggggcgaa ctcgatctac aaaatcctga aggccgtgct cgagcgtctc      1380
     aagaccaaac cccatgccat caatccccaa ttgatcgaaa tggtccgcga ttcgcaggag      1440
     ctgctcaaac ccattctgct caaggaaggc catctcgacc ggcaggagaa ggaaaaggtc      1500
     aagaacctca tcgcacggtt ccagacccag cgcgacaaga cctctctgga caaggcgccg      1560
     atcacatcgc ggcttgcgac ggaagccgac gccgggatgg aagtcgatca ggccgtcccc      1620
     ctggccactc ttcccgagga tcaaatcgct tttgtcgacc gccgaccgat cagcgccttg      1680
     aagggttggc tcgaagcgtc ccgggcactg gtgagtgaga cggttcaggg actcgaattt      1740
     gaaaacaggc ggcttcggca gatcgagcaa atcctgggca agaccaaggc actggagccg      1800
     ctcgttgcgc gtctcgaggg catacgggcg aacgtggaga agcacgtcct ggcattcaag      1860
     tcgagggagc ccgaatggga cgagcgtatc cggtggcttg gggagcttga tgtgacgatc      1920
     tcgagccgcg gcgggcaagt gccgcgtccg gccgaagacg ccgtggaact ggaggaagtg      1980
     gtgctcgagg ccgaggaact ccgggaaccg ggatatgcgc cggcgttttc cgtcgaggga      2040
     gatgtcagac cggaccaggt atactacttc agtatgggtg gcaggaaatt cgccgtgctt      2100
     gcctcgcagg tggtcaagat cgacaaggtc tccggggcga aggtgaaaaa gttcgtcaag      2160
     cagggctatg cttccctcaa cgatttcaag cccatgttca agaacatcaa ggcaggcctt      2220
     tttggaacgt ggggaggact gccgctcgag gttctcaagg gctatcgatt tgtgcctatc      2280
     cccgcagagg tttttggcgg cgagtcattg cccgcccgct caggcggggc gattctgctg      2340
     agcagcggca agcggcacgg gatcgtgttt tgtgattccg cggtcgtgga tcttcacaat      2400
     gatgtcgaga tcgtgatcgg caaggcgagc gatgaccgga tgctcggaag catcatgggc      2460
     gtggcggacg cacccgttga agtgctgaat ctggaccgga ccgtaagatc gctgggttag      2520
//

If you have problems or comments...

PBIL Back to PBIL home page