(data stored in ACNUC7421 zone)

EMBL: CP000478.PE318

CP000478.PE318       Location/Qualifiers
FT   CDS_pept        387069..387344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16022"
FT                   /db_xref="InterPro:IPR021734"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF20"
FT                   /protein_id="ABK16022.1"
FT                   /translation="MLFLAIFSYSPEDRDDVIQRGMGTGTKHQGVEVKGEWFDISGHRV
FT                   FRLFEADDEVHLAASVYAWTDLGIAEIIPVMETEKALKFLKRVGTK"
     atgttatttc ttgccatttt cagctattcc cctgaagacc gggacgacgt tatccagaga        60
     ggcatgggaa ccggtaccaa acaccagggt gtggaagtca agggtgaatg gttcgacatc       120
     tccggccatc gggttttcag actgttcgag gccgacgacg aggtccacct ggcggcgtcc       180
     gtctatgcct ggacggacct cggaatcgcc gaaatcattc ccgtcatgga aacggaaaag       240
     gccctgaaat tcctcaaacg ggtcggtaca aagtaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page