(data stored in ACNUC7421 zone)

EMBL: CP000478.PE324

CP000478.PE324       Location/Qualifiers
FT   CDS_pept        392003..392446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16028"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF26"
FT                   /protein_id="ABK16028.1"
FT                   /translation="MAVPLAGHLQARKKARFHVQVKIGNIPTDIQTPAQVLVEGTVVRI
FT                   FRSDGNLRPGDRVVFPVWVCRPGDDVPVGPVCGFLDRLASATHIEVYLNGAPPRCDVAL
FT                   DEWLPLETASDEPRLTVEELERQIREARKKKRRWWWFRPNTTP"
     atggccgttc cgctggctgg gcatttgcag gcccgcaaga aagcgcgctt tcatgtccag        60
     gtgaaaatcg ggaatattcc caccgatatt cagaccccgg cgcaggtgct cgttgaaggc       120
     accgtcgttc gcatctttcg gagtgacggt aacctgaggc ctggcgaccg ggtcgttttc       180
     ccggtgtggg tctgccggcc gggggacgac gtcccggtgg gaccggtctg cgggtttctg       240
     gatcggcttg cgtccgcgac gcatatcgaa gtttacctga acggggcccc gccgcggtgc       300
     gatgttgccc tggacgagtg gctgccgctg gaaaccgctt ccgatgagcc gcgcctcacc       360
     gtggaggagc tcgaacgaca gatcagggaa gcacgcaaga agaaacgcag atggtggtgg       420
     ttccggccga acacaacacc gtga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page