(data stored in ACNUC7421 zone)

EMBL: CP000478.PE326

CP000478.PE326       Location/Qualifiers
FT   CDS_pept        393986..394276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16030"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF28"
FT                   /protein_id="ABK16030.1"
FT                   /translation="MGASHVAQSRFRLNGKVSEPAFNSPCLLPNPRLAGPRCASNGTPG
FT                   RPEFHGFCRGDRRGPPGGCIIEAGTGVFGLGLQEYFVNGLYSLKIFKVKAL"
     atgggcgcct cccatgtcgc gcagtctcga ttcagactga acggcaaggt gtcagagccc        60
     gcgttcaaca gtccgtgcct gctccccaat ccacggctcg ccgggcctcg ttgcgcttcg       120
     aacggaaccc ccggcaggcc cgaattccac ggcttctgcc gcggggaccg gcgcggtcct       180
     cccggcggtt gcatcatcga ggccggaacc ggggtcttcg gtctcggcct ccaggaatat       240
     tttgttaacg gactatactc cttaaagatt ttcaaagtca aggcactgta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page