(data stored in ACNUC7421 zone)

EMBL: CP000478.PE327

CP000478.PE327       Location/Qualifiers
FT   CDS_pept        complement(394590..394982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16031"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF29"
FT                   /protein_id="ABK16031.1"
FT                   /translation="MFRAIGITLRHFARLGGRARLSSTAIARDDRTIAKALQVSPKGFA
FT                   FRRVACLRINFNPSPDSLIGASASMFMPPPLPGGSPVAAHHPRPWLHRNGRICCGFKTF
FT                   RMQNAMNKKARRNQEKGAANTCEKTG"
     atgttccggg ccatcgggat tacgctccgg catttcgcgc gcctgggtgg aagagcaaga        60
     ctttcttcga ctgcgatcgc aagggatgat cgcaccatcg cgaaagccct tcaggttagc       120
     ccgaagggtt ttgcttttcg gcgcgtggca tgcctccgca tcaactttaa cccgtctccc       180
     gatagcttga tcggcgcctc ggcaagcatg ttcatgcctc ccccgctccc gggcggttcg       240
     ccggtcgcgg cacaccatcc gagaccctgg cttcaccgga atggtaggat ctgctgcggg       300
     ttcaagacgt ttcgtatgca aaacgccatg aacaagaaag cgaggcgcaa ccaggaaaag       360
     ggagctgcga atacatgcga aaagacggga tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page