(data stored in ACNUC7421 zone)

EMBL: CP000478.PE328

CP000478.PE328       Location/Qualifiers
FT   CDS_pept        complement(395006..395467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0332"
FT                   /product="Cache, type 2 domain protein"
FT                   /note="PFAM: Cache, type 2 domain protein; KEGG:
FT                   ade:Adeh_3161 cache domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16032"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF30"
FT                   /protein_id="ABK16032.1"
FT                   /translation="MSKKLLIAVVIVVLGLSWAYAQQQQAVDEKALAKAMVEKAAAFLN
FT                   ENGKEKTIAEINKPDGQFVQGELYVFAYDLNAVMLAHPKNPKLIGQSLMDKPDSKGKLF
FT                   RKEIIDKAKSAGSGWVDYFYLNPQTGKEEAKTTYLKKAGDMVICCGAYR"
     atgagcaaga agctattgat cgccgttgtg atcgttgtgc tgggcctttc ctgggcgtat        60
     gcccagcaac agcaggccgt agacgaaaag gccttggcca aggcgatggt ggaaaaggcc       120
     gccgcctttc tgaacgaaaa cgggaaggag aagaccatcg cggaaatcaa caaacctgac       180
     ggccagttcg tgcagggcga gctctacgta ttcgcctacg acctcaacgc cgtcatgctc       240
     gcccacccca agaacccgaa gctgatcggt cagagcctca tggacaagcc tgacagcaaa       300
     ggaaagctgt tccgaaagga aatcatcgac aaggccaaga gcgccgggag cggctgggtg       360
     gactacttct acctgaatcc ccagacgggc aaggaagaag ccaagaccac ctatttgaag       420
     aaagccggag acatggtgat ctgctgcggc gcgtacaggt aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page