(data stored in ACNUC7421 zone)

EMBL: CP000478.PE329

CP000478.PE329       Location/Qualifiers
FT   CDS_pept        396201..396512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16033"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF31"
FT                   /protein_id="ABK16033.1"
FT                   /translation="MSFEQWGYEFDGAYSVADRLQPRAGVYVVWCKIEDKWKVIGVGQS
FT                   ENVGKQLVDGERTLCWADECKPGTIYFAATYTDGAPESERKCIEQLIRRLTNNLREGA"
     atgtccttcg aacagtgggg ttacgaattt gacggcgcgt acagtgtcgc ggacaggctt        60
     caacccaggg cgggtgtgta tgtggtttgg tgcaagatcg aagacaagtg gaaagtgatc       120
     ggcgtcggcc agtcggaaaa cgtcggcaag cagcttgtcg acggcgaacg gactttgtgc       180
     tgggccgatg agtgcaagcc gggaacgatc tactttgccg ccacctatac cgacggtgct       240
     ccggaatcgg aaaggaagtg catcgaacag ttgatccgcc ggttgacgaa taacctgcgg       300
     gaaggggctt ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page