(data stored in ACNUC7421 zone)

EMBL: CP000478.PE330

CP000478.PE330       Location/Qualifiers
FT   CDS_pept        396530..397195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16034"
FT                   /db_xref="GOA:A0LF32"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF32"
FT                   /protein_id="ABK16034.1"
FT                   /translation="MPSGCSFRRREGDAANGKALSPTPAAASPGGEVHPLPVAGTSEHL
FT                   RIDPPQSGETLHRPPVSLMSLSLNDKTSAMLYNDCVRAGGSPIRPEDRGLRSGVRRKRG
FT                   ADDSRALAGKGTAPSVQVPATPGVSGHASACGTIHKMRNAAPSGPGYEERLRFFNYIRH
FT                   LGRTIAWAMIVLLIGIASGTFFLREGSSAEACLLPLALCVIPVAVLTVVKPGRRDAGG"
     ttgccgtcag ggtgttcttt ccggcgtcgg gagggagatg ccgcgaacgg gaaggctctg        60
     agcccgacac ccgcagccgc ctcgcccgga ggcgaggtcc atccgctccc cgttgcggga       120
     acgtcggaac acctccgaat agacccgcca cagtccggtg aaacattgca ccggccgccc       180
     gtttccctga tgtccctttc cctgaatgac aagacatccg cgatgttgta taatgattgc       240
     gttcgtgccg gagggagccc gattcgcccc gaagatcgag gtttgcgctc cggcgtccga       300
     aggaaacgcg gcgcggacga ttcgcgcgcc ttggccggga aggggactgc gccgtccgtg       360
     caggttccgg cgacacccgg cgtgtcggga cacgcgtccg catgtggaac gatacacaaa       420
     atgagaaacg cagctccatc cggccccggt tacgaagaac gcctcaggtt cttcaattat       480
     atccgtcatc tcggccgcac gatcgcgtgg gcgatgatcg ttctcctgat cggtattgcg       540
     tcgggcacct tttttttgcg ggagggcagc agcgcggaag cgtgcctctt gccgttggcc       600
     ctgtgcgtca tccccgtcgc cgtgctgaca gtggtgaaac ccggccgcag ggacgccggc       660
     ggttga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page