(data stored in ACNUC7421 zone)

EMBL: CP000478.PE331

CP000478.PE331       Location/Qualifiers
FT   CDS_pept        complement(397278..397592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16035"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF33"
FT                   /protein_id="ABK16035.1"
FT                   /translation="MPPGAMHRACGNFPAVHFVRLFTAASVSSSLPSPASRAVLAFLTG
FT                   AWVCSRKTFGDSAAGVSTLVAFFSGSFALEQPAAPAHQIKDRIAIPAKIRLMAASSLLQ
FT                   "
     gtgccgcccg gggcaatgca ccgcgcgtgc ggcaacttcc cggcggttca cttcgtcagg        60
     ctcttcacgg cggcatcggt gtcatcgagt ctcccgtccc ctgcgtcgcg agccgtcctg       120
     gctttcctca ccggggcctg ggtgtgttcc cgcaagacgt tcggagattc ggcggcggga       180
     gtctcgacac tggtcgcctt cttctccggc tccttcgccc tggagcagcc cgcggccccc       240
     gcgcaccaga tcaaggacag aattgcgatc cccgccaaaa tccgtctcat ggcagcctcc       300
     agtttgctcc aatga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page