(data stored in ACNUC7421 zone)

EMBL: CP000478.PE332

CP000478.PE332       Location/Qualifiers
FT   CDS_pept        complement(397600..397965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0336"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG: gsu:GSU1192
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16036"
FT                   /db_xref="GOA:A0LF34"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF34"
FT                   /protein_id="ABK16036.1"
FT                   /translation="MNEREFTRVTLHTTAEVRWGDEVVTGEVENLSLNGVFVKSSAQVP
FT                   ADTPVEITILLVGASSELSVRIKGEVVRREPHGFAVRFQGMNLDSFFHLRSFFVARNAD
FT                   EKAIRAEYREHIRKKGS"
     atgaacgagc gagaattcac cagagtcacc ctgcacacaa cggccgaagt gagatggggg        60
     gacgaagtcg tcaccggcga ggtcgagaac ctcagcctga acggagtgtt cgtcaaatcg       120
     tcggcacagg taccggcgga caccccggtg gaaatcacca ttttgctcgt gggagcatcg       180
     tcggagctgt ccgtcaggat caagggagag gtggtcaggc gggaacccca cggattcgcg       240
     gttcggttcc aagggatgaa cctggattcg ttctttcacc tccggagctt cttcgtcgcc       300
     cggaacgccg acgaaaaagc aatccgcgca gaataccggg agcacatccg gaagaaaggg       360
     tcttga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page