(data stored in ACNUC7421 zone)

EMBL: CP000478.PE334

CP000478.PE334       Location/Qualifiers
FT   CDS_pept        complement(398439..399479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0338"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase, subunit II; KEGG:
FT                   dvu:DVU3270 cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16038"
FT                   /db_xref="GOA:A0LF36"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF36"
FT                   /protein_id="ABK16038.1"
FT                   /translation="MLESIWFVLWGVLWAIYFMLDGFDLGLGALMPVLARGENDRRTIY
FT                   RAMGPFWDGNEVWLITAGGVTFAAFPVAYAVMFSGLYSALMLVLFALIFRGIALEYRSH
FT                   LASERWRKTWDTCLTVGSFAAALLLGVAFANIFKGIPIDGEGVFQGSLLTLLNPYGIFG
FT                   GVLFVLMFTVHGSLWLTLKSDGELHARAARLAEKLWIVLAVAAVGFLVATWYATRLYDN
FT                   YLKEPMLFAVPIVLIPVITIAALAFIRVGIVKRRYWRAWFASSVFIVGVTLFGVAGLYP
FT                   NLLPSSLDPAFSVNVHNASSSPLTLRIMLVVALVFVPVVLAYQTWAYRLFKSRLEDGES
FT                   LHDEAY"
     atgctcgaat cgatctggtt tgtgttgtgg ggtgtgttgt gggcgatcta cttcatgctg        60
     gacggcttcg acctcggact cggcgccctc atgccggttc tcgccagggg tgaaaacgac       120
     cggcgcacca tctatcgcgc catgggcccc ttctgggacg ggaatgaagt atggctgatc       180
     acggcgggcg gggtcacctt cgccgcgttt ccggttgcct acgccgtgat gttcagcggt       240
     ctgtactcgg cgctgatgct cgtcctgttc gccttgatct tccgcggcat cgcgcttgaa       300
     taccgatcgc acctggcgag cgagcgctgg cgaaaaacct gggacacctg cctgacggtc       360
     gggagcttcg ccgccgcact gctgctcggg gtggcgttcg ccaacatctt caaaggcatt       420
     cccatcgatg gcgagggcgt cttccagggc agtcttctca ccctcctcaa cccttacggc       480
     atcttcggag gcgtgctgtt cgtcctgatg ttcacggtgc acggctccct gtggctgacc       540
     ctgaagtccg acggcgaatt gcacgcgcgt gccgcgcggc ttgcggagaa gctctggatc       600
     gtgctcgccg tggccgcggt cggtttcctc gtggccacgt ggtatgccac ccggctctat       660
     gacaactatc tcaaggaacc gatgctcttc gcggtcccca tcgtcctcat tccggtcatc       720
     accatcgccg ccctcgcgtt cattcgcgtc ggcatcgtca agcggcggta ttggagggcg       780
     tggtttgcat ccagcgtgtt catcgtgggc gtgaccctgt tcggagtggc ggggctctat       840
     ccgaacctgc tcccgtcgtc gctcgatccg gccttcagcg tgaacgtgca caatgcgtcg       900
     tcgagccccc tcaccctcag gatcatgctc gtcgtggctc tcgtcttcgt gcccgtggtg       960
     cttgcctacc agacctgggc ctaccggctc ttcaaaagcc gtctggaaga cggggaatcc      1020
     ctgcacgacg aagcctattg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page