(data stored in ACNUC7421 zone)

EMBL: CP000478.PE337

CP000478.PE337       Location/Qualifiers
FT   CDS_pept        complement(401413..401721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16041"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF39"
FT                   /protein_id="ABK16041.1"
FT                   /translation="MRPGDVFIERTLELVEKMISIADEGDRTREDRGCGVLCGVLRDSA
FT                   FKIRRLAEEERELHARQGPSGPEQPLRGARAPSGRGASARNSGRGKSRGKPAGTASK"
     atgaggccgg gtgacgtgtt catcgagagg acgctcgaac tggtcgagaa gatgataagc        60
     atcgccgacg aaggggatcg gacccgggag gatcgcggct gcggggtgct ttgcggcgtg       120
     ctgcgggatt cggcgttcaa gatcagaaga ctcgccgagg aggaacggga gctccacgcg       180
     cggcagggac cctcgggacc ggaacagccg ctccgcggag cgcgcgctcc ttccggtcgg       240
     ggggcaagcg cacggaatag cggccgcggg aagtcccgcg gaaaaccggc cgggaccgct       300
     tcaaaatga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page