(data stored in ACNUC7421 zone)

EMBL: CP000478.PE338

CP000478.PE338       Location/Qualifiers
FT   CDS_pept        complement(402002..403336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0342"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="KEGG: sat:SYN_01181 transcriptional regulator with
FT                   sigma 54 interaction domain; TIGRFAM: PAS sensor protein;
FT                   PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16042"
FT                   /db_xref="GOA:A0LF40"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF40"
FT                   /protein_id="ABK16042.1"
FT                   /translation="MSDRAFDRILADKRNLEHILDNLMEGIISHDRNRRILFFNRAAEN
FT                   ITGYAREEVIGRDCHEVFGSPFCGQRCSFCGESPDLIDHKSYVVNILTRKGEPRRIEMS
FT                   VTGMVDEDGRFLGVLAAFRDLTDLFGMKLRLGEINSFAGIIGKDHKMLQVFDQIRDLAT
FT                   NDFPVHISGETGTGKELAAAAIHNESHRGGGPFVPVNCGALPEGLLESELFGHVKGAFT
FT                   GAIRDKKGRFELAHGGSIFLDEVSELPRFMQVKLLRVLQEGTFTRVGGESTIVVDVRVI
FT                   SASNRDLKKEVESHNFREDLYYRLNVVPIRIPPLRERKNDIPLLAAHFLEQAVKRGQKS
FT                   AVLSEDALAAMMDYSWPGNVRELQNAVYFALVKSRGSTLHVDDLPLELARTAPICKPGP
FT                   ARKLDRDSVAAALKQSGGNKARAARLLGVGRATLYRFLDDFENVP"
     atgagcgatc gtgcctttga cagaatcctt gccgacaaga ggaacctgga acacattctg        60
     gacaacctga tggaagggat catctcgcac gacaggaacc ggcggatcct gttctttaat       120
     cgcgcggcgg agaacatcac cgggtatgcg cgggaagagg tgatcggcag ggactgccac       180
     gaggttttcg gatcgccttt ctgcgggcag cgctgctcct tttgcggtga aagcccggac       240
     ctcatcgatc acaagagtta cgtcgtcaac atcctcaccc gcaagggcga gcccaggcgg       300
     atcgaaatgt ccgtcacggg catggtcgac gaagatggac gtttcctcgg agtcctggcc       360
     gccttccgcg atctcaccga tcttttcgga atgaagctgc gcctggggga aatcaacagt       420
     ttcgcgggca tcatcgggaa ggatcacaag atgctccagg tgttcgacca gatccgcgac       480
     ctggccacca atgacttccc ggtgcacatt tccggtgaaa cgggaacggg caaggaactg       540
     gcggcggcag ccattcacaa cgagagccac cggggcgggg ggccgttcgt tcccgtcaac       600
     tgcggcgcgc tgcccgaagg gctgctcgag agcgaattgt tcggacatgt caagggcgct       660
     ttcaccggcg ccattcgcga caagaaggga cgtttcgaac tggcccacgg cggcagcatt       720
     ttcctcgatg aggtctcgga gcttcccagg ttcatgcagg tcaagctcct gcgcgtgctc       780
     caggaaggca ctttcacacg cgtcggcggg gaatcgacca tcgtcgtgga cgtaagggtc       840
     atcagcgcgt ccaaccgtga cctgaaaaag gaagtggaat cccacaactt ccgtgaagac       900
     ctgtattatc ggctcaacgt cgtgccgatc cgcataccgc cgttgagaga acgcaagaac       960
     gacatccccc tgctcgctgc tcactttctt gaacaggccg tgaaacgcgg acaaaaatcg      1020
     gccgtccttt ccgaagacgc cctggccgcc atgatggact attcctggcc cggaaacgtg      1080
     cgggaacttc aaaacgccgt ctatttcgcg ttggtcaaat ccaggggctc gaccctccac      1140
     gtcgacgacc tgccgctcga actggcgcga accgcgccga tctgcaagcc cggtcccgcg      1200
     cgcaaactcg accgggactc cgttgccgcc gccctcaaac agagcggggg caacaaagcg      1260
     cgggcagcca ggctcctcgg ggtgggccgt gccacgctct atcgtttcct ggacgatttc      1320
     gaaaacgtcc catga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page