(data stored in ACNUC7421 zone)

EMBL: CP000478.PE339

CP000478.PE339       Location/Qualifiers
FT   CDS_pept        complement(403852..406767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0343"
FT                   /product="DnaK-related protein"
FT                   /note="KEGG: mca:MCA1306 DnaK-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16043"
FT                   /db_xref="GOA:A0LF41"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR021030"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF41"
FT                   /protein_id="ABK16043.1"
FT                   /translation="MTANASMEAETPSFQYIIGIDLGTTNSAVGYVDLSASGADDAAVR
FT                   FLEIPQLVAPGELGNRPVLPSFLYLPGPYELPPGSTALPWAPERSYAVGEFAREQGALV
FT                   PGRLVSSAKSWLCHGGVDRTHAILPWGAAENLDRISPIEASSRILLHIREAWNEVMAHG
FT                   REEHFLEEQLVVLTVPASFDEVARELTVRAAHEAGIRRIVLIEEPLAAFYAWLWKHEAD
FT                   WRTLMRPGQLILVCDVGGGTSDFTVIAIREDALGLRLDRLAVGEHLMLGGDNMDLALAR
FT                   HVEEVMQGGTGRLDSRRWQQLWHHCRKAKETLLGTVESAGPPAGRPSAPDSVDLTIVGS
FT                   GGRLIAGTLTATLSRETVKELTLDGFFPFTNLDDVSPPAAGAVLSEGGLPYVGDPAVTR
FT                   HMAAFWRRHRPLLLRETGRSRLYPDFLLFNGGALIPETIRDRLLRVVREWFRAEAGDEW
FT                   SPVELENPRPDLSVAIGAAYYGRVRLGRGVRVGAGSPRTFYVEVAPPGDRTVEEGHRTA
FT                   VCLLPRGAEEGYEAELERPEFQVRTNQPVSFGVLASSTRIGDSPGEILSLPNHELTVLP
FT                   PIRTALRYGRKGSAAALPVRLAVHLTDIGTLELWCRSTSGPHRWQLQFDVRHNAEDETR
FT                   PSPAGETFEAGRIDEAGAAIAAVFRRSAGRTLRPPERLVKDLVEIFEVKRERWPASLVR
FT                   KLADALLEDREGRSLTAQHEARWLNLLGFCLRPGYGDPLDEWRAKEAWKLYPAGLSFAR
FT                   QPQNRSEWWIFWRRAAGGLSAGQQQRICQEVLPGLQLEEQRKKGTTRKGGAPRTVQEEL
FT                   ETWMMLANLERLPAAVKTSLGRLMLRRLQRGAPRPQELWTFARFGARVPFYGPLDQTVP
FT                   REEAALWLAALLDLDLEPTQPLARTLVSLSRLTGDRARDLDRADRDRVLRRLESIPGTS
FT                   HLRALVNDARTDLEGTEREWLYGESLPSGLIVVEGAETVEP"
     atgacggcga atgcgtccat ggaagcggaa acgccttcct ttcaatatat catcggaatc        60
     gatctcggga ccacgaattc ggctgtgggc tacgtggacc tgtcggcgag cggggcagac       120
     gacgctgccg ttcgttttct cgagatacct cagttggttg cacctggaga actcggcaac       180
     cgtccggtat tgccttcctt tctttatctt ccgggcccct acgagcttcc ccccgggagt       240
     acggccctgc cgtgggcgcc tgagcgttct tacgcggtgg gcgaattcgc acgcgaacag       300
     ggagcccttg tgcccggccg ccttgtctct tccgccaagt catggttgtg ccacggcggg       360
     gtggaccgca cccatgcgat tctgccctgg ggcgcggccg aaaacctcga ccgcatctcg       420
     cccatcgagg cgagctctcg aatcctgctc cacatccggg aggcatggaa cgaggtcatg       480
     gcgcatgggc gcgaggagca cttcctggaa gaacagctgg tcgtattgac cgtccccgcg       540
     tccttcgatg aggtcgcccg cgagctcacg gttcgggcgg cccatgaggc ggggattcgc       600
     cggatcgtgc tgatcgaaga gcctcttgcg gccttctatg cctggctgtg gaagcacgag       660
     gcggactggc gcaccctgat gcgcccgggc cagttgatcc tggtctgcga cgtgggaggc       720
     gggacttcgg acttcaccgt gatcgccatc cgcgaagacg cgctgggatt gcggctcgac       780
     cggctggccg tgggagagca cctcatgctg ggcggcgaca acatggacct tgccttggcg       840
     cgacatgtcg aggaagtcat gcagggcggc acgggacggc tcgattcgag aaggtggcag       900
     cagttgtggc accattgccg gaaagccaag gagacgctgc tcggaacggt tgagagcgcc       960
     ggcccgcccg ccggacggcc aagcgccccc gattccgtgg acctcaccat cgtcggttcc      1020
     ggaggcaggc tcatcgccgg gaccctcacg gccactctca gccgggaaac ggtgaaggag      1080
     ctgaccctcg acggtttctt tccgttcaca aacttggacg atgtttcgcc gccggccgcc      1140
     ggggcggttt tgtccgaagg gggactcccc tatgtcggcg acccggccgt gacgcgtcac      1200
     atggcggcat tctggcggcg gcaccgcccg cttctgctcc gggaaacggg acgcagccgg      1260
     ctctatcccg atttcctgct tttcaacggc ggagcattga tcccggagac catccgggac      1320
     cgcctgctgc gcgtcgttcg ggagtggttc agagcggaag ccggcgatga atggtcgccc      1380
     gtcgagctgg aaaacccgcg acccgacctg tccgtggcga tcggagcggc ctattacggc      1440
     cgggtaagat tggggcgggg agtccgggtc ggggcgggaa gtccgcgcac gttctacgtc      1500
     gaggtcgccc cgccagggga ccggacggtg gaggaaggac accgcaccgc cgtgtgcctg      1560
     ttgccgagag gcgcggagga agggtacgaa gccgagcttg aacggcccga attccaggtg      1620
     cgcaccaatc aaccggtttc cttcggggtg ctggcttcga gcacccgcat cggagacagc      1680
     cccggcgaaa tcctgtccct gccgaatcat gagctcacgg tgctgcctcc catacgcacc      1740
     gcgctgaggt acggacggaa aggctcagcg gcagcacttc cggtgcgcct tgcggttcat      1800
     ctcaccgata tcggcaccct ggagctttgg tgccgttcga catcgggtcc tcaccgctgg      1860
     cagcttcagt tcgacgtccg gcacaacgcc gaggatgaaa cccggccgtc gccggccggg      1920
     gagacattcg aggcgggccg catcgacgag gccggggcag cgattgccgc ggttttccga      1980
     aggagcgccg ggaggactct gcgccctccc gaacggctgg tgaaggactt ggtggagatc      2040
     ttcgaagtga agcgggagag atggcccgca tcgctcgttc gcaagctggc cgacgccttg      2100
     ctcgaagacc gggaggggcg ttccctgacc gcgcagcacg aagcgcgctg gttgaacctg      2160
     cttgggttct gcctgcgtcc cggatacggc gacccgctcg acgagtggcg cgcaaaggaa      2220
     gcctggaagc tgtatcccgc gggactgagc ttcgctcggc aaccacagaa ccgctccgaa      2280
     tggtggatct tctggagacg ggcggccggg ggcctcagcg ccggccaaca acagcgcatc      2340
     tgccaggagg tgctccccgg gctccaactc gaggagcaac ggaaaaaggg gaccacgcgc      2400
     aaaggaggcg ctccccggac ggtccaggaa gaactcgaga cctggatgat gcttgcaaac      2460
     ctcgaacggc tgccggccgc cgtcaagaca agcctcgggc gtctcatgct gcgacggctc      2520
     caacgaggcg cccctcggcc ccaggaactc tggacgttcg cccggttcgg ggcacgcgtc      2580
     ccgttctacg gtcctctgga tcaaaccgtg ccccgcgaag aagcggctct ctggctggcc      2640
     gccctcctcg acctggacct cgagcccacc cagccccttg cccgaaccct ggtctccctt      2700
     tcgaggctca cgggcgaccg agcccgggac ctcgatcgcg cggaccgcga cagagtactc      2760
     cgccgtctcg agtcgattcc cgggacgagc cacttgcgcg cgctcgtcaa cgatgcccgt      2820
     acggacctcg agggaacgga gcgtgaatgg ctctacggcg aatcgctgcc ttcggggctc      2880
     atcgtggtgg agggggcgga gacggtcgag ccgtga                                2916
//

If you have problems or comments...

PBIL Back to PBIL home page