(data stored in ACNUC7421 zone)

EMBL: CP000478.PE342

CP000478.PE342       Location/Qualifiers
FT   CDS_pept        complement(409211..410356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0346"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="KEGG: sat:SYN_01563 tetraacyldisaccharide 4'-kinase;
FT                   TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16046"
FT                   /db_xref="GOA:A0LF44"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LF44"
FT                   /protein_id="ABK16046.1"
FT                   /translation="MQTSIILGTGRFQAIRRLSARVRRLWYSAPETLRGGPLLSAIKLT
FT                   SMTYRAGFEMDRRRSRFRRRRLPAYVVSVGNLAVGGTGKTPLTLWLARYFKNGGRRVAV
FT                   LSRGYGRSGSAPGRVPSSGELSVLALEYGDEPAMLALELGDTPVYVGKHRWESGILAIE
FT                   SSRADLVILDDGFQHHALERDLDLVLLDASNPFGNGFTLPLGPLREPKAHLARAHAIVL
FT                   TRAVEPESVARTRAQLDKAFPDKPVFAAQHILRGFHAGLGGAVVPLRSMVARPAVAFAG
FT                   IADPKSFFSLLEALEIDLRMAFAFPDHHRPTARDTAALFDAVRACSADLLITTQKDAVR
FT                   LPGFLRRVVCVPDLEIDFGEDETRFRRFLDRETRGRQAMPE"
     atgcagacgt caatcatcct cggcacgggg cgttttcagg ccatcagacg gctttcggcc        60
     cgcgtgcggc gactgtggta ctcggccccc gagacccttc gcggaggtcc cctgctttcc       120
     gccatcaagc tgacttccat gacttaccgg gcaggcttcg agatggaccg gcggcgatcc       180
     cgtttccgcc gacgccgcct gcccgcatac gtcgtcagcg tggggaacct ggccgtggga       240
     ggaaccggca agacgcccct taccctgtgg ctcgcccgat atttcaagaa cgggggccgt       300
     agagtcgcgg tgctcagcag aggatacggg agaagcggga gcgccccggg ccgcgtgcct       360
     tcctcgggcg agttgtccgt cctggcgctc gagtacggcg acgaaccggc catgctggca       420
     ctcgaactgg gagacacgcc ggtatatgtc ggaaagcacc gatgggaatc cggaatcctt       480
     gcgatcgaat cttcccgggc ggatctcgtc attcttgacg acggctttca acatcatgcg       540
     ctcgaacggg atctcgatct cgtcctgctg gatgcgtcaa atcccttcgg aaacggtttc       600
     acgctgcccc tgggaccatt gcgcgaaccc aaggcacact tggcgcgtgc gcacgccatc       660
     gtcctgactc gagccgtcga accggagtct gtcgcgcgca ctcgcgcgca actcgacaaa       720
     gcctttcccg acaagccggt atttgcggca cagcacatac tgagggggtt ccacgcgggt       780
     ctggggggag ccgtcgttcc cttgaggagc atggtcgcac ggcctgccgt ggcttttgcg       840
     gggatcgccg accccaagtc cttcttttct ctgctcgaag cgctggagat cgacctgcgc       900
     atggcgttcg cctttccgga ccatcaccgg ccgacggccc gcgataccgc cgccctgttc       960
     gacgcagtcc gtgcctgttc ggctgacttg ctcatcacca ctcaaaagga cgccgttcgg      1020
     cttcccggat ttctgcggcg cgtggtgtgc gtgcccgacc tggaaatcga ctttggagag      1080
     gacgagacgc gcttccgccg gttcctggat cgggagaccc gtggacggca agcgatgccc      1140
     gaatga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page