(data stored in ACNUC7421 zone)

EMBL: CP000478.PE347

CP000478.PE347       Location/Qualifiers
FT   CDS_pept        complement(414257..414898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_0401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16051"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF49"
FT                   /protein_id="ABK16051.1"
FT                   /translation="MPATRLRGREAGPPFPFHRLCPVPITRTEESSEFRRPMTDECWQD
FT                   AVRTLAGQIDPAHRRLLEAVANEISLNIKALDTLMDRYCRETCPSCGNPCCDGREVFYN
FT                   RADLLYLLGTGKPVPPGQTRRTPGEACRYLTSGGCLLPRDERPYVCVWFLCEPQMGLFQ
FT                   AEKPATQRQVINTLLDTRSYRLGLESLHDKSGCRLKEVHSTGSECPCTEK"
     atgcccgcga cacgcctgag gggccgcgaa gccggacccc ccttcccttt tcatcggctt        60
     tgccctgtgc cgatcacaag gaccgaggag tcttccgaat ttcgccgtcc gatgaccgac       120
     gaatgctggc aggatgccgt caggaccctg gccgggcaga tcgaccccgc gcacaggcgc       180
     cttcttgaag ccgtcgcaaa cgagatctcc cttaatatca aagcgctgga cacgctcatg       240
     gaccgttact gcagggagac ctgcccgtcc tgcgggaacc cctgctgtga cggccgggaa       300
     gtgttctata accgcgccga cctcctctac ctccttggaa ccggcaaacc tgtccctccg       360
     ggccagactc gcaggacccc gggtgaagcc tgccgatatc tgacctccgg gggatgcctg       420
     ctccccaggg acgaacggcc ctacgtctgc gtgtggttcc tgtgcgagcc gcagatgggg       480
     ctgtttcaag ccgagaagcc tgcgacccag agacaagtga tcaacacgct gctcgatacg       540
     aggtcatacc gacttggact ggaaagcctt catgacaaga gcggttgcag actgaaagag       600
     gttcactcga ccggttccga atgtccctgc acggaaaaat aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page