(data stored in ACNUC7421 zone)

EMBL: CP000478.PE348

CP000478.PE348       Location/Qualifiers
FT   CDS_pept        complement(414900..415379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0352"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: plt:Plut_1294
FT                   universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16052"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF50"
FT                   /protein_id="ABK16052.1"
FT                   /translation="MVDIGKILVLVDFSRNSAEAVRYGLTLAHSLGARLCFLHTVNQRI
FT                   MDALQELSSKGYKGDFLQALRKLMEDRENDLREFVSKEELAGVEAEFLIRKGEPVEEVV
FT                   SAAGEYSIDLIVVGSQGHAASANGSVGTVAQDVINRARCPVLVVRPIEHDFIEEP"
     atggtcgata tcgggaaaat actcgttctt gtcgatttct ccaggaattc agccgaagcg        60
     gtccggtacg gtctgaccct cgcccacagt ctcggggccc ggctgtgctt tctgcacacg       120
     gtcaatcagc gcattatgga tgccctgcag gaattgagca gcaagggcta caagggtgac       180
     ttcctgcagg ctctcaggaa attgatggag gatcgggaaa acgacctccg ggagttcgtg       240
     tcgaaagaag agttggcggg agtcgaggcg gaattcctga ttcgcaaggg cgaaccggtg       300
     gaggaggtcg tcagtgcggc cggggagtat tcgatcgatc tcatcgttgt ggggagccag       360
     gggcacgccg cgtcggcaaa cggctcagtc ggcaccgtcg cgcaggacgt gatcaatcgg       420
     gcccggtgcc cggttctggt ggtgcggccc attgaacacg atttcatcga ggaaccctga       480
//

If you have problems or comments...

PBIL Back to PBIL home page