(data stored in ACNUC7421 zone)

EMBL: CP000478.PE349

CP000478.PE349       Location/Qualifiers
FT   CDS_pept        complement(415426..416094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0353"
FT                   /product="DNA-3-methyladenine glycosylase III"
FT                   /EC_number="3.2.2.-"
FT                   /note="PFAM: helix-hairpin-helix motif; HhH-GPD family
FT                   protein; KEGG: gme:Gmet_0070 HhH-GPD"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16053"
FT                   /db_xref="GOA:A0LF51"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF51"
FT                   /protein_id="ABK16053.1"
FT                   /translation="MMTDRNGLIRLIFDRLHGFFGPQNWWPADTPFEVIVGAILTQNTS
FT                   WKNVARAVANLRDHGLLSFEALCAVPEPLLAELIRSSGYYNQKARKLKAFCRHVCETGH
FT                   AGLDGFLAQDTDTLRSELLRIRGVGPETADSIVLYAAHKPSFVVDTYTHRVFSRHGWVQ
FT                   ESPSYDELRGFFMDCLEPDVGLFQELHALLVRTGHLFCRKTPRCGGCPLEGLRAGTAAG
FT                   "
     atgatgaccg accgaaacgg gctcatccgg ttgattttcg atcgcctcca cggtttcttc        60
     ggcccccaga actggtggcc ggcggacacc cccttcgagg tcatcgtggg tgcgatcctc       120
     actcagaaca cctcatggaa gaacgtggcg cgtgccgtcg caaacctgcg ggatcatggg       180
     ctcttgtctt tcgaggcttt gtgcgcagtc ccggaaccgc ttctcgccga attgatccgc       240
     tcttccggtt actacaacca gaaagcccgc aaattgaagg ccttctgccg gcacgtttgc       300
     gaaacagggc acgcgggcct cgacggattt ctcgcccagg ataccgacac gctgcgttcc       360
     gagttgcttc gcatccgcgg cgtgggtccc gaaaccgccg acagcatcgt gctctacgcc       420
     gcccataagc cttctttcgt ggtcgacacg tacacccacc gggtattctc ccgtcacgga       480
     tgggtgcagg agtccccgag ctacgacgag ctcagggggt ttttcatgga ttgcctcgaa       540
     ccggatgtcg gtctcttcca ggagctccat gccctgctgg tgcggaccgg acacctgttc       600
     tgccggaaaa ccccgcgttg cggcggttgc ccgctcgagg gtctccgtgc gggaacggcg       660
     gccggatga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page