(data stored in ACNUC7421 zone)

EMBL: CP000478.PE351

CP000478.PE351       Location/Qualifiers
FT   CDS_pept        complement(417283..418182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0355"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: dvu:DVU3369
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16055"
FT                   /db_xref="GOA:A0LF53"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF53"
FT                   /protein_id="ABK16055.1"
FT                   /translation="MERSVGYVFRPEDALMVEELSQTPAGRLALLIEQELLLRLWRPLT
FT                   PQRVLEVGCGTGLFLERLVREGHIVTGIDASPAMLEIARRRLAPRVALRQGFAEDLPFD
FT                   DNEFDTVALIGTLEYVNDPVAALREAFRVARQHVLLGAANRYSLETFKLCAQRLWKRSF
FT                   YDHARFYSVYRLRHLVERALAGSVPVRWGTCLSFPLGLLKYVRFLERSRLLQWHPLGHF
FT                   IGMRVDMVYPMQTIQTPLFAEVTSRMDRSRARASCWRSLAGDKGFCRFAPGLDGTGAFH
FT                   PPSTAGRMRISRPPISDR"
     gtggagcgat ccgtgggata cgtgtttcgc cccgaagatg ccctgatggt cgaggagttg        60
     tcccagactc ccgcgggacg tcttgcactt ctcatcgagc aggaactcct gctgagactg       120
     tggcgccccc tgactccgca gagggtcctg gaagtcggat gcggaaccgg gctcttcctc       180
     gagcggcttg tccgggaggg gcacattgtg acgggcatcg atgcgtcgcc ggcgatgctg       240
     gaaatcgcgc gccgcaggct ggctccccgg gttgcgttgc gccagggatt cgcggaggat       300
     ttgcctttcg acgataacga attcgacact gtggcgctca tcggcacact cgaatacgtc       360
     aatgacccgg tggcggcgct cagggaagcc ttccgagttg cccggcagca tgtgctgctg       420
     ggcgccgcca accgatattc gctcgagact ttcaagctct gtgcgcaaag gctctggaaa       480
     cgttctttct acgatcatgc gaggttctac agcgtgtacc gtctgcggca tcttgtggaa       540
     cgggcgctgg caggttcggt ccccgtgcgg tggggaacct gcctctcctt tcccctgggc       600
     ctcctgaaat acgtgcgctt cctggaacgg tcgcgcctcc tgcagtggca tcccctggga       660
     catttcatcg gcatgcgggt cgacatggtt tatcccatgc aaacgatcca gaccccgctg       720
     tttgcagagg tgacctcgag gatggaccgg agcagggcca gagcctcatg ttggcgttcc       780
     ctggccgggg acaaaggatt ttgccgcttt gccccgggcc tcgacggaac aggggcgttc       840
     catccacctt caacggcggg gcgaatgaga ataagccggc cccccatatc cgatcggtag       900
//

If you have problems or comments...

PBIL Back to PBIL home page