(data stored in ACNUC7421 zone)

EMBL: CP000478.PE355

CP000478.PE355       Location/Qualifiers
FT   CDS_pept        425356..427839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0359"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: glycoside hydrolase, family 13 domain protein;
FT                   alpha amylase, catalytic region; alpha amylase, C-terminal
FT                   all-beta; SMART: alpha amylase, catalytic sub domain; KEGG:
FT                   rba:RB548 1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16059"
FT                   /db_xref="GOA:A0LF57"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF57"
FT                   /protein_id="ABK16059.1"
FT                   /translation="MSWIPVHFTYHVGLQGGIFRNVRLVGSWDANGSHSDQWTGVPMRE
FT                   EVSDSGCPCFRATVNLNGDQAGWTFGWGVLLDGPGGANRWGITTEVHDRNSSERFRGFQ
FT                   LKGPEQFNEYHLTHCRRLGANKLHRPGGGEPAVRFAVWAPNALHVEMVRGDAATGYIDD
FT                   NGTGALAAFPMHKEMVDGTWTGIWRTDDDSEGLESFAQFDHTPYMFRITKDDDTVCYRT
FT                   DLYSRCQIGSGKKNPEGKKYDGRPTGLAGSVSCSVVVDPERVTELFDEPFPQKQWLDAD
FT                   EFWKNEFDPLRPVPTRIDDLVIYEMHVPGLGCGKTDAAGEPFTGDLKDAVQMLDYLVDL
FT                   GVNAVEVLPMNEFEGWAAWGYATSHYFAVEYAGGGRDQFKHFVRECHRRGLAVLLDVVY
FT                   NHYAHNAERAEWMYDSNRHEKNIYYWYEGMPSDYRDYEHAAGDPTLDPRKRPASGHGGY
FT                   VDNMSTGYAPRFCEEMVRKMFISSAAALVHEFHVDGFRVDQTTSIHSYAVVHADGRAAA
FT                   DARIFGAKFLRELTRTLKLIKPTVMLIAEDHSGWSAVTEPPDKGGLGFDAYWYADFYHH
FT                   LIGDTDKGADYAKLIKTCGFGDDRPLAVDYFVGALRHAGNLTVVYHESHDEAGNAKFSG
FT                   RTIAVAVNRATLSGETRRWAEARCRLACGLNMLSPGVPMFFMGEEVGFQKDYPYDLFLS
FT                   QREDFLRERGGSGANLFRFYQDIIKLRRRKPALRTAGLVPLHVRNDNRVLVFRRSLENE
FT                   HLIVFASFNNYAFVDGYRVNEAEIPDGAWREIFNSDAAVYGGNNVGNGGMVRESRYGSM
FT                   DAVIPANGFVVFERL"
     atgtcttgga tacccgttca tttcacttat catgtgggcc tgcaaggcgg catattccgc        60
     aatgtcaggc tggtgggcag ctgggatgca aacggcagcc attccgacca atggaccggc       120
     gttcccatgc gggaagaggt ctcggacagc ggctgcccct gcttcagggc caccgtgaac       180
     ctcaacggcg accaggccgg gtggaccttc ggctggggcg ttctgctcga cggcccggga       240
     ggcgccaatc gatggggcat caccacggaa gtgcacgacc gcaactcgtc ggaacggttc       300
     cgcggattcc agctcaaagg gcccgagcag ttcaacgaat accatctcac ccactgccgc       360
     cggttgggcg ccaacaagct ccaccgtccc ggcggcggtg agccggccgt acgctttgcc       420
     gtctgggcgc ccaacgcgct ccacgtcgag atggtgcgcg gggatgccgc cacgggctac       480
     attgacgaca acggcacggg ggcactggcc gcgttcccga tgcacaagga gatggtcgac       540
     ggaacgtgga ccgggatatg gcgtaccgac gacgattcag agggtctgga gagctttgcg       600
     cagttcgatc acacgcccta catgttcagg atcaccaagg atgacgatac cgtctgctac       660
     cggacggacc tctattccag gtgccagatc gggagcggca aaaagaatcc cgaggggaaa       720
     aagtacgacg gaagaccgac cgggctggcc gggtcggtga gttgctcggt ggtggtcgat       780
     cccgaacgcg tcaccgagct cttcgatgag ccctttcctc agaagcaatg gctggacgcg       840
     gacgagttct ggaaaaacga gttcgatccg ctgcgcccgg tgccgacgcg catcgacgac       900
     ctggtcatct acgaaatgca tgtccccggg ctgggatgcg ggaaaacgga tgccgccggt       960
     gagccgttca ccggcgatct gaaggatgcc gtgcagatgc tggattacct ggtcgatctt      1020
     ggcgtcaacg ccgtggaagt cctgccgatg aatgaattcg agggatgggc ggcctggggc      1080
     tatgcgacgt cccactattt cgccgtcgag tacgcggggg gagggcgtga ccagttcaag      1140
     cacttcgtgc gtgaatgcca tcggcgcggc cttgcggtgc tcctggacgt cgtttacaat      1200
     cattacgcgc acaacgccga aagagcggaa tggatgtacg attccaatcg tcacgagaag      1260
     aacatctact actggtacga gggcatgccg tccgattatc gcgactacga gcacgccgcc      1320
     ggcgatccga ccctcgatcc ccgcaaaagg cccgcttccg gtcacggagg gtacgtcgac      1380
     aacatgtcca ccggctatgc gccccggttt tgcgaggaaa tggtgcgcaa gatgttcatc      1440
     agcagcgccg cggccctggt gcatgaattc cacgtggatg ggttcagggt ggatcagacc      1500
     acctccatcc acagctacgc cgtggtccat gccgacggcc gcgccgccgc cgatgcccgc      1560
     attttcggcg ccaagttcct tcgagagctc acgcgcaccc tcaaactgat caagccgacg      1620
     gtcatgctca tcgccgagga ccattccgga tggtccgccg tgacggaacc cccggacaag      1680
     ggcggtctgg gtttcgatgc atactggtat gccgatttct atcatcacct catcggcgat      1740
     accgacaagg gcgccgacta cgcaaaactc atcaagacct gcggctttgg cgacgaccgc      1800
     cccctggccg tcgattattt cgtcggcgcg ctgcggcatg cgggcaacct taccgtcgta      1860
     taccacgaat cccacgacga ggccggaaac gcgaagttct cggggcgcac catcgccgtg      1920
     gccgtcaacc gggcgactct ttcgggggag acgaggcgct gggccgaagc gcgctgccgc      1980
     ctggcctgcg gcctgaacat gctgtctccg ggagttccca tgttcttcat gggagaggag      2040
     gtcgggtttc agaaggatta tccgtacgat ctctttctga gccaacggga ggattttctg      2100
     cgcgagcgcg gtggcagcgg tgcgaacctg ttcaggttct accaggacat catcaagctg      2160
     cgtcgccgaa aacccgcgct gcgaacggcc gggctcgttc cgctgcacgt ccgcaacgac      2220
     aaccgcgtgc tggtgttcag gcgctccctg gaaaacgagc acctcatcgt tttcgccagt      2280
     ttcaacaatt acgcattcgt cgacggctat cgcgtgaacg aagccgaaat ccccgatggc      2340
     gcctggcggg agatcttcaa cagcgacgcg gccgtctacg ggggcaacaa cgtcggcaac      2400
     ggcgggatgg tgcgtgagtc ccgatacggt tcaatggacg ccgtcatccc cgcaaacgga      2460
     ttcgtcgttt tcgaaaggct gtag                                             2484
//

If you have problems or comments...

PBIL Back to PBIL home page