(data stored in ACNUC7421 zone)

EMBL: CP000478.PE357

CP000478.PE357       Location/Qualifiers
FT   CDS_pept        428830..429771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0361"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dps:DP0197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16061"
FT                   /db_xref="GOA:A0LF59"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF59"
FT                   /protein_id="ABK16061.1"
FT                   /translation="MRTIFGPVPSRRLGRSLGIDVIPPKTCSYNCVYCESGLTTHLTVK
FT                   RRAFVRPEDVLAELREYFLEHPGGADALTFSSAGEPTLYEPLEELVRAVKEAYASLPLI
FT                   VLTNGSLLWHPEVRRALLRADRVVPSVDAISDEAFKCVNRPHPELDNDSILDGLRAFRK
FT                   EYKGQLHVEVMLVSGLNDNREELLRLSRFVEELGPERVELNTVVRPPAQWGTTGLSARR
FT                   MEECASFFPAGKTDVIGRFQRAEGQGEDPDLSGRILELVSRRPCSIEEMAASLGVPEVE
FT                   LRRAVMSLEADNRLTRYLYNEIEFLCSPECRR"
     gtgaggacga tttttggccc ggtgccgtcc cgtcggctgg gacggtctct gggcatcgat        60
     gtcattcccc cgaaaacgtg cagttacaat tgcgtctatt gcgaatcggg gcttaccacg       120
     catctgacgg tgaagcggcg ggcgtttgtc cggcctgagg acgtccttgc ggagctgcga       180
     gagtatttcc tggagcatcc cggaggcgcc gacgcgctga cgttttccag cgcaggcgaa       240
     ccgacgctct acgagcccct ggaagagctg gtccgtgccg tgaaggaagc ctacgcgtcc       300
     ctgcccctga tcgtgctcac caacggttcg ctgctgtggc atccggaagt gcgccgcgct       360
     ctgctgcggg ccgaccgtgt cgtcccgtcc gtggacgcga tatcggacga agccttcaag       420
     tgcgtcaacc ggccccaccc cgagctcgac aacgattcga ttctcgacgg tctgcgagcg       480
     ttccggaagg agtataaagg gcagctgcac gtcgaggtga tgctggtctc gggcctgaac       540
     gacaaccggg aggaattgct gcgactgagt cgttttgtcg aggaattggg gccggagcgc       600
     gtggagctca acacggtcgt tcgcccgccc gcgcaatggg gaacgacggg gctttcggcg       660
     cggcggatgg aagaatgcgc aagctttttc ccggccggaa aaaccgatgt gatcgggcgt       720
     ttccagcgcg cggaagggca gggggaggac cctgacctga gcggacgcat cctggagctg       780
     gtttccaggc ggccctgttc catcgaggaa atggcggcat ccctcggcgt acccgaggtg       840
     gagctgcggc gggccgtcat gtcgctcgaa gccgacaacc gcctcacgcg ctacctctac       900
     aacgaaatcg aattcctgtg ctcgcccgag tgcaggaggt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page