(data stored in ACNUC7421 zone)

EMBL: CP000478.PE358

CP000478.PE358       Location/Qualifiers
FT   CDS_pept        complement(429914..432646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0362"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   mxa:MXAN_1141 peptidase, M16 (pitrilysin) family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16062"
FT                   /db_xref="GOA:A0LF60"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF60"
FT                   /protein_id="ABK16062.1"
FT                   /translation="MICRLLFGICVALSLLGPGVVARCAAAQICPSLPPPLQPSVQRIL
FT                   SSKPGDLFVVLKNGLTLLMSQKPNYDVVSAQVFVRAGSIYEGKYLKSGLSHYLEHVVSG
FT                   GTTRSFTEDQAKERLKKIGGNSNAYTSHDRTVYYINTSAEHWKDALDLLLSYVSECTLE
FT                   PTEVAREKPVIQQEIKMGESNPSNELWKLFLRTAYQVSPVRNPVIGYEEVFVRLDRQAL
FT                   LDYYAQRYQPENIVVVVAGNISPEAVLSFVADKTKDFLGTAGEFDAVPVEPAQSTTRRQ
FT                   EKEIPVARLTQAMVGFPSVDLNHQDMYALDVLSLLLGGGETCRLHCRLKDMENKVLSVS
FT                   ASNWTPSYTKGQFIVSFTLPPDEWPGVLSQLGEEIEVFKRDLVPMKELDKAKKTAMASH
FT                   VFSNETVSSIAASLGSSYFSTGDPYYDDTYVEEIRRLTPEGIRSAAQRYLIMDRINVAA
FT                   TKPLSRQAAATPDTASCPPREASPAHMSKLDNGLKVLLKRDDSLPMVTMHLYGLGGLML
FT                   EDGDKPGIASLTSALMTSGTLTRTRQQILQSIEDVGGSIETQSENSTYHVSIKILKEDF
FT                   HTALDILADIVRNAQYPEEEIEKKRQDTLLAIQRMDESWQAEIVRLFKKNYFEKSPYRN
FT                   DRLGTRESVESISRDDLLRFHRRMVNPGQAVLAVYGDIDAEKTSERVRQLFGTWEQGEV
FT                   KYPELPDETTQISANRVVEKKNEKGSAALFVGTNGFAIRNSRRATLDVLDAVLSGAGNP
FT                   GGRIFEALRGKQDLVYVVGAFPFYGNNAGYFGVITQTTMANLDKVQGIILDNLRILARE
FT                   PVPADELEKAKSQIVTAHRLHMESLDAQAGSAAINEVLGLGWQYDKEYLKEVQAVGPAD
FT                   VRNLAKELFAHTLIARTIPERPVEVLSVPPPSKSDVRAQ"
     atgatctgta gactgctgtt cggaatctgc gtggcccttt cactcctggg gccgggtgtc        60
     gtcgcacgct gtgccgcggc gcaaatctgt ccttcgctgc cgcccccgct tcaaccctcc       120
     gtgcaacgaa tcctgtcgtc caaacccggc gaccttttcg tcgtcttgaa aaacggcctg       180
     acactgctca tgagtcagaa accgaactac gacgtggtct cggcccaggt tttcgtccga       240
     gcgggctcaa tttacgaagg gaaatacctc aagtccggtc tttcccacta tctcgaacac       300
     gtcgtctcag gcggcacgac ccgctcgttc accgaggacc aggcgaaaga gaggctgaaa       360
     aagatcggcg gcaattccaa cgcctacacc agccacgacc gcaccgtcta ctacatcaac       420
     acttcggcgg aacactggaa ggatgccctg gaccttcttc tttcctacgt ctccgaatgc       480
     accctggagc ccacggaggt cgcgcgggaa aagcccgtga tccagcagga gatcaagatg       540
     ggggaaagca atccgagcaa cgagctctgg aagctttttc tcaggaccgc ctaccaggtc       600
     agccccgtca ggaacccggt catcggttac gaggaagtct tcgtgcggct ggatcgacag       660
     gcgctgctcg actactatgc ccaacgctat caacccgaaa acatagtggt cgtggtggcc       720
     gggaacattt cccccgaagc ggtgctgtcc tttgtcgccg acaagacgaa ggattttctc       780
     ggaacggccg gcgagttcga cgccgtgccc gtcgagccgg cacagtcgac gacgcgtcgc       840
     caggaaaagg aaatccccgt cgcgagactt acccaggcca tggtcgggtt cccgtccgtg       900
     gatctgaatc accaggacat gtacgcgctg gacgtgcttt ctctcctgct gggaggcggc       960
     gaaacctgcc gtctccactg ccgcctcaag gacatggaaa acaaggtgct cagcgtgagc      1020
     gcctccaatt ggaccccatc ctacacgaaa ggccagttca tcgtttcctt cacactgccc      1080
     ccggatgagt ggccgggagt actctcccag ctcggggagg agatcgaggt cttcaagcgg      1140
     gacctcgtac cgatgaaaga gctggacaag gcgaaaaaga ccgccatggc cagtcacgtt      1200
     ttcagcaatg aaaccgtttc ttccatcgcg gcttctttgg gcagctccta cttcagcacc      1260
     ggagaccctt attatgacga cacgtatgtg gaggaaatcc gccgcctgac gcccgagggc      1320
     atccgctcgg cggcacagcg ctatctgatc atggaccgaa tcaacgttgc ggcaaccaaa      1380
     ccgctgtccc ggcaggcggc ggcaacgccg gacacggcgt cgtgtccgcc tcgggaagct      1440
     tcgcccgctc acatgagcaa gcttgacaac gggctgaagg ttctgctcaa acgggacgac      1500
     tcgcttccca tggtcacgat gcatctgtat ggcctgggag ggctgatgct cgaagacggg      1560
     gacaaaccgg ggatcgcctc cctgacctcc gcattgatga cctcggggac gctgacccgc      1620
     accagacagc agattttgca gagtatcgag gatgtcggag gcagtatcga gacgcagtcc      1680
     gaaaacagca cgtatcacgt gtcgatcaaa atcttgaaag aagacttcca cacggcgctc      1740
     gacatccttg cggacatcgt gcgcaacgcc cagtatccgg aggaggaaat cgagaagaaa      1800
     cgccaggaca cgctcctcgc catccaaagg atggacgaga gctggcaggc ggagatcgtg      1860
     cggttgttca agaagaacta ctttgaaaaa tcgccttatc gtaacgaccg tctggggacc      1920
     cgcgaatcgg tggaatccat ttccagggac gacctcctcc ggttccaccg acgcatggtg      1980
     aatcccgggc aggccgtgct cgccgtgtac ggcgatatcg acgccgaaaa aacgtcggag      2040
     cgggtccgac agctgttcgg gacctgggaa cagggagaag taaaataccc cgaactgcct      2100
     gatgaaacga cccaaatctc cgcgaaccgc gtggtcgaga agaagaacga gaaaggctca      2160
     gccgctctgt ttgtcggcac caacgggttt gccatccgga attccaggcg ggcgacactc      2220
     gatgttctgg acgccgtcct ctcgggggcg ggcaaccccg gcgggaggat attcgaagcc      2280
     ctgcgcggga agcaggacct ggtttacgtg gtcggggcat ttccgttcta tggcaacaac      2340
     gccggttact tcggcgtgat cactcaaacc accatggcca acctcgacaa agtgcaggga      2400
     atcatattgg acaacctgcg cattctggcc cgggaacccg ttcctgcgga cgaactggaa      2460
     aaagcgaaga gccagatcgt caccgctcac cggctgcaca tggaaagcct cgatgcacag      2520
     gccgggagcg cggcgataaa cgaggtgctg ggactgggct ggcaatacga caaggaatat      2580
     ctcaaagagg ttcaggcagt cggtccggcc gacgtccgca acctggcgaa ggaattgttc      2640
     gcgcacacgc tgattgcccg caccatcccg gaacgaccgg tggaggttct ctccgtgccg      2700
     ccgccgtcca agtcggatgt gcgcgcgcaa tag                                   2733
//

If you have problems or comments...

PBIL Back to PBIL home page