(data stored in ACNUC7421 zone)

EMBL: CP000478.PE359

CP000478.PE359       Location/Qualifiers
FT   CDS_pept        complement(432918..433862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF61"
FT                   /protein_id="ABK16063.1"
FT                   /translation="MFWRVPRSIAIPCMERQSLSAAHPVYVALARGLESCAAVLTLGLR
FT                   ESIGAYSAEERDLLREARVVFFPSIRFVDVLEATGKRTFPSPSTYRFQRSRLQQELLIR
FT                   YLGIPHPRTRFYYGARQKRHILEGFEYPFLAMGPGHVSSPPRIVRNADDLGRACRAFNP
FT                   VVIQETPAWDERLRLICVGDACAGALRLHGGGGEAAGWEPVDIEAMRTGDARATRLPGG
FT                   SETAAGSTRVHGHTGSGKRAPGRGGAEAAVFRSTHDLMRTAGLDDMVFEWARAGTCWYL
FT                   VRMERPPSTWLTPAGRVHHGRHLCKLIQSGAFS"
     atgttctgga gagttccgcg atcaattgcg attccgtgta tggaaagaca atcactgtcc        60
     gccgcacacc ccgtttacgt tgccctcgcc cgcggccttg agtcatgcgc ggccgttctg       120
     acgcttggtc tgagggaatc catcggcgcc tattcggccg aggagcggga cctgcttcgc       180
     gaggcaaggg tggtcttctt cccctccatc cggtttgtcg atgttctgga agccaccggg       240
     aaaagaacgt ttcccagccc atccacctat cgtttccagc gctcgcggct gcaacaggaa       300
     ctgctcatcc gctacctggg tatccctcac ccccgtaccc ggttctacta tggagcgcgg       360
     cagaaacgcc atatcctcga agggttcgaa taccctttcc tcgccatggg gcccggacat       420
     gtctcatccc ctccccgaat cgtgcgcaac gcggacgatt tgggccgggc gtgtcgggcc       480
     ttcaacccgg tcgtgattca agagaccccg gcatgggatg agcggttgcg cctgatctgc       540
     gtcggcgacg cgtgtgccgg cgcgctgcgg ctgcacggcg gaggaggcga ggcggccgga       600
     tgggaaccgg tggacattga ggcgatgcgg accggagatg cgcgggcaac ccgattgccc       660
     ggagggagcg agaccgccgc ggggtcgaca cgcgtccatg gtcacaccgg atccggaaag       720
     cgtgcgccag ggcgtggcgg agccgaggct gcggttttca ggtccaccca tgatctcatg       780
     aggaccgcgg gtctggacga tatggttttt gaatgggcac gcgcgggcac ttgttggtac       840
     ctggtgcgaa tggagcgccc tccctcgaca tggctgaccc ctgccggccg ggtgcatcac       900
     ggtcgccacc tgtgcaagct gatccaatcc ggcgcttttt cctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page