(data stored in ACNUC7421 zone)

EMBL: CP000478.PE36

CP000478.PE36        Location/Qualifiers
FT   CDS_pept        52074..52727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0037"
FT                   /product="formate dehydrogenase, beta subunit, putative"
FT                   /note="KEGG: dde:Dde_0812 formate dehydrogenase, beta
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15740"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE88"
FT                   /protein_id="ABK15740.1"
FT                   /translation="MSKGKSIMVDTSRCTACRGCQVACKQWNGLPGTKTKQVGTYQNPQ
FT                   DVSAETWKLVRFSEGIKENGKPYWYFFSEQCRHCLEPPCVDSIGGYQPEGATRDEATGA
FT                   VIFKPASKEAPFEEVKGACPYNIPRQDAKSKVFFKCTMCLDRITNNRIPACVQSCPTGA
FT                   MAFGERDAIVEMVKKRVEELKKTYPKAMALNPDEVRVIYIVTDDPKKYHQYAVA"
     atgtcgaagg gaaaatccat aatggtcgat acctccaggt gcaccgcctg ccgtggctgc        60
     caggtggcct gtaaacaatg gaacggtttg cccggcacga agaccaagca ggtgggcacg       120
     tatcagaacc cccaggacgt ctccgcggaa acgtggaagc tggtccggtt ttcggagggg       180
     atcaaggaaa acggaaaacc ctactggtat ttcttttcgg agcaatgccg gcattgcctc       240
     gaaccgccgt gcgtggattc catcggcgga taccagccgg agggtgcgac gagggatgag       300
     gcgacggggg cggtgatctt caaaccggca tccaaggagg cgcctttcga ggaagtcaag       360
     ggcgcctgcc cgtacaacat tcctcgccag gacgccaaga gcaaggtgtt tttcaagtgc       420
     accatgtgtc ttgaccgaat caccaacaac aggatcccgg cgtgcgtcca gagttgtccc       480
     accggcgcga tggcgttcgg ggagcgggac gccatcgtcg aaatggtgaa gaagcgcgtc       540
     gaggagttga agaagaccta tcccaaagcg atggcgctca acccggacga ggtccgggtg       600
     atctacatcg tcacggacga tccgaagaag taccatcagt acgcggtggc atga             654
//

If you have problems or comments...

PBIL Back to PBIL home page