(data stored in ACNUC7421 zone)

EMBL: CP000478.PE37

CP000478.PE37        Location/Qualifiers
FT   CDS_pept        52769..53779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0038"
FT                   /product="protein involved in formate dehydrogenase
FT                   formation"
FT                   /note="KEGG: sat:SYN_00636 protein involved in formate
FT                   dehydrogenase formation"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15741"
FT                   /db_xref="GOA:A0LE89"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE89"
FT                   /protein_id="ABK15741.1"
FT                   /translation="MRNRDGRRLSEEEYLMEQESLAARAAGRVADALKKTSEENRYLRT
FT                   VLAPFAGLLMEQARWKAELPETEAGNALAPDATRFGNGIPVTDRQSLICLGDLWKEAAE
FT                   RLVPPFADGFAEVADGLRRLQYAILKGGFDPDSYWSRVLKNRNAAVPDEVRAIGLEPEV
FT                   LQFALIQLAKPVVERRAEGLQPLIKSLTWNKGYCPICGSLPELSLLKGKEGHRWLRCAF
FT                   CAGEWRFHRTTCPNCESQKPDDIELCYVEGREHERVELCHNCMTYVVSVDVRTLADEIV
FT                   PEVARLGLLHLDAIAQRREFRPMNPTGWTKSAPAGAAADEASGRASGASGGTMLH"
     ttgcgaaatc gcgacggacg acggttgtcg gaagaggagt atctcatgga acaggaatcc        60
     ctggcggcaa gagccgcggg aagagtagcc gatgcgttga agaagacctc ggaagaaaac       120
     cgttatctcc gtacggtgct ggcgcccttt gccggccttc tgatggagca ggcgcgctgg       180
     aaagccgagc tgcccgaaac ggaggccgga aatgccctcg ctccggacgc gacgaggttc       240
     ggcaacggaa tcccggtgac ggacaggcag agcctcattt gcctcgggga tttgtggaaa       300
     gaggccgccg agcgcctcgt tccgcccttt gccgatgggt ttgccgaagt cgccgatggg       360
     ctcaggcggc tgcagtacgc gatactcaag ggcgggttcg atccggactc ctactggagc       420
     cgcgtgctga agaaccggaa tgcggcagtg cccgacgagg tccgagcgat cggtctggaa       480
     cccgaggttc tccagtttgc cctgatccag ttggcgaagc cggttgtgga aagacgtgcc       540
     gagggtttac agcccctgat caagagcctg acctggaaca agggatactg cccgatctgc       600
     ggatcgcttc ccgaattgag tcttctcaag ggcaaggaag ggcatcgctg gctgcggtgc       660
     gcgttttgtg cgggtgaatg gcgttttcac aggaccacct gtccgaactg cgaaagccag       720
     aaaccggacg acattgaatt gtgctacgtc gaaggcaggg aacacgaaag ggtcgagttg       780
     tgccacaatt gcatgaccta cgtggtgagc gtggatgtca ggaccctcgc cgacgagatc       840
     gttcccgaag tcgcgcggtt gggcctgttg cacctcgacg ccattgccca gagaagagaa       900
     tttcgaccca tgaacccgac cggatggacg aaatcggcac cggcgggcgc cgccgcggat       960
     gaggcaagcg gccgcgcatc cggggcttca gggggcacca tgctccacta g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page