(data stored in ACNUC7421 zone)

EMBL: CP000478.PE371

CP000478.PE371       Location/Qualifiers
FT   CDS_pept        complement(448053..449141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0375"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase I;
FT                   PFAM: glycosyl transferase, family 9; KEGG: pca:Pcar_1264
FT                   heptosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16075"
FT                   /db_xref="GOA:A0LF73"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF73"
FT                   /protein_id="ABK16075.1"
FT                   /translation="MTISKPLRKMLVVKPSALGDIIHALPFLDAVSRSHPGIAIHWVAA
FT                   RGLHEILVDHPMIRKLWIIDKNAWKRPAALPRTVHEIMNLASGLRRERFDIVVDLQGLL
FT                   RSGMICAVSGAGMRLGFSDAREGSPLFYTHGINGGRDVHAVTRCLRMAETLGCDTREVR
FT                   FPLPALPARNLFPQWCGDDYLVIAPGAGGAAKQWPVRFFGELAARLPLKSLVVGGASDA
FT                   VLAAEVQRLSHGHAVSIAGMTGLRELAAVIGGARALVSSDTGPMHIAAALNVPVVAVFG
FT                   PTNPARTGPFGSIHTAVVADVPCSPCYKRKRCREWRCMESIGVRQVLDAVLSRLAEPPP
FT                   AATYGDDDRAGPAVRLQNEKAS"
     atgacgattt cgaaaccgct ccgcaagatg ctcgtggtca aaccgagcgc cctgggcgac        60
     atcatccacg ccctgccgtt cctggacgcg gtgagccgga gtcatccggg aatcgcgatc       120
     cactgggttg cggcccgcgg gttgcacgag atccttgtgg accatccgat gatccgcaaa       180
     ctgtggatca tcgacaagaa cgcatggaag cgcccggccg ccctgccccg gacggtgcac       240
     gagataatga acctggcgtc gggcctgcga agggaacgct tcgacatcgt cgtcgacctg       300
     caggggttgc tgcgaagcgg tatgatttgt gccgtgagcg gggccggcat gcggctcggg       360
     ttcagtgatg ccagagaagg aagtcctctt ttctacactc atggaatcaa tggaggcagg       420
     gacgttcacg cggtgacgcg ctgccttcgc atggccgaga ccctgggatg cgacacgcgg       480
     gaagtccgct ttcccctgcc cgcgcttccc gcccggaacc tgttcccgca atggtgcggc       540
     gacgactacc tggtgatcgc gccgggagcg ggtggtgccg caaagcaatg gccggtgcgt       600
     ttttttggag aactggcggc gaggctgccc ctcaaatcgc tggtggtggg gggagcctcc       660
     gacgccgtcc tcgcggcgga agtgcaaagg ctctcgcacg gtcatgccgt ctccattgcc       720
     ggcatgaccg gcctccggga gttggccgcg gtcatcggag gcgccagggc gctcgtctct       780
     tcggacacgg gtcccatgca catcgccgcg gccctcaacg tgcccgtggt ggccgtcttc       840
     ggccccacca accctgcccg aaccggtcct ttcggttcca ttcacaccgc cgtcgtggct       900
     gacgtccctt gctcgccgtg ttataagaga aagcgctgcc gagaatggcg gtgcatggaa       960
     tccatcggcg tgcggcaagt cctggacgcc gtgctgtcca gactggcgga gccgccgccc      1020
     gcagcgacgt atggcgatga cgaccgtgcg ggaccggcgg ttcgtcttca aaatgagaag      1080
     gcgtcatga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page