(data stored in ACNUC7421 zone)

EMBL: CP000478.PE374

CP000478.PE374       Location/Qualifiers
FT   CDS_pept        complement(451701..452891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0378"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   gme:Gmet_1823 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16078"
FT                   /db_xref="GOA:A0LF76"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF76"
FT                   /protein_id="ABK16078.1"
FT                   /translation="MNGNTRLRVLFIVATAFALALCPLWTGARAADPIKIGAFFALSGP
FT                   ASSIGTPTKLVAQMVVDKINKEGGINGTPLELVVGDTESDPTKALMEAKRLIEAGKAAA
FT                   LIGPTRTDEGMAVKAYIEDTAHIPIVMTIGGDPVIAGGKFGPFKWTFKAPQRTSVAARK
FT                   TYDFIRSLKLTKIAVLTATDGFGKDGLTWLEQLAPEFGLEIVAKEAFGVTDTDMSPQLL
FT                   KIKASGAQAVICWTIGPAGARVAKNVKQLALGIPLVQCHGQPDPKYIELAGDAAEGSIM
FT                   PSTKLMVVDQLPDSDPQKAVIMEFIKLYTDVYHFDKQYPINTHSGYAWDAIYLAANAMR
FT                   KVGTDAEKLRAAIEQTKGYVGVSGVFNLTPEDHNGLGTDSLVMVKVEKGKWVLLKP"
     atgaacggaa acacgaggct gagggtcctt ttcatcgttg cgacggcatt tgcccttgcg        60
     ctctgcccgc tgtggacggg agcgcgggcg gccgatccga tcaagatcgg cgcgtttttc       120
     gccctgtccg ggcccgcatc gtccatcggc actccgacga agctcgtcgc ccagatggtg       180
     gtggacaaga tcaacaagga aggcggaatc aacggcacgc cgctcgaact ggtcgtaggg       240
     gacacggaaa gcgacccgac caaggcgctc atggaggcca agcggctgat cgaggccgga       300
     aaggcggcgg cactcatcgg ccccacaagg accgatgaag gaatggcggt gaaggcatat       360
     atcgaagata ccgcccacat ccccatcgtg atgaccatcg gcggcgatcc ggtcatcgcc       420
     ggaggcaagt tcggcccttt caagtggacg ttcaaggccc cccagaggac atcggtcgca       480
     gcccgaaaaa cctatgactt cattcgttcc ctgaagctga ccaagatcgc cgtcctgacc       540
     gccaccgacg gattcggcaa ggacggcctg acctggctcg aacaactggc tcccgaattc       600
     ggcctggaaa tcgtcgccaa agaggcgttc ggggtgaccg atacggacat gagtccgcag       660
     ttgttgaaga tcaaggcgag cggcgcccag gcggtgatct gctggaccat cggaccggcc       720
     ggcgcgcggg tggccaagaa cgtgaaacag cttgccctcg ggattcctct ggtccaatgc       780
     cacgggcagc ccgatcccaa gtacatcgag ctggccggag acgcggcgga gggcagcatc       840
     atgccctcca ccaagctgat ggtcgtggat caactgccgg acagcgatcc ccagaaagcg       900
     gtcatcatgg aattcatcaa gctgtacacg gacgtatacc atttcgataa gcaatacccg       960
     atcaacacgc attccgggta cgcctgggat gccatctatc ttgcggccaa cgccatgcgc      1020
     aaggtgggca ccgacgccga gaagctccgc gccgccatcg agcagaccaa gggctacgtg      1080
     ggggtgagcg gggttttcaa tctcacgccc gaagaccaca acggccttgg aaccgattcc      1140
     ctggtcatgg tgaaggtgga aaagggcaaa tgggtgttgt tgaaaccgtg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page