(data stored in ACNUC7421 zone)

EMBL: CP000478.PE379

CP000478.PE379       Location/Qualifiers
FT   CDS_pept        complement(459107..459832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0383"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gsu:GSU1730 branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16083"
FT                   /db_xref="GOA:A0LF81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF81"
FT                   /protein_id="ABK16083.1"
FT                   /translation="MLRVKGLSVRYGSVQVLRRVSFHVAENEIVALIGANGAGKSTLLR
FT                   ALSGINRPFEGEILFRGEPLLKVSPERIVRMGLVQVPEARQLFPNMTVLENLELGGYLY
FT                   GLKHVRAKLAEIYELFPVLMERSRQKAGTLSGGEQQMLSIGRALMARPRLLVLDEPSMG
FT                   LAPLIVEEIYRTVEALHREGTTVLLVEQNAMGALAVAERGYVLETGRIVLSGRADELME
FT                   HDDVQRAYLGKDYEYKWER"
     ttgcttcgag tcaagggtct atcggttcgc tacggttcgg tccaggtcct gaggcgggtc        60
     agttttcacg tggccgaaaa cgagatcgtc gccctgatcg gggccaacgg cgcgggcaag       120
     agcactctcc tgcgggcgct gtccggcatc aaccggccct ttgaagggga gattttgttc       180
     aggggcgagc cgctcctgaa agtcagcccc gagcgcatcg tccgcatggg gctggttcag       240
     gtgcccgaag cccggcagtt gtttccgaac atgacggtgc tcgagaacct cgaactgggg       300
     gggtaccttt acggtctcaa gcacgtgcgc gccaagctgg cggaaatcta cgagctgttt       360
     cccgtcctga tggagcgcag caggcagaag gcgggaaccc tcagcggcgg ggagcagcag       420
     atgctctcca tcggccgcgc cctgatggcc cggccgcgac tgctcgtcct ggacgaaccg       480
     tcgatggggc tggcccccct gattgtcgag gagatctacc ggaccgtcga ggcgttgcat       540
     cgtgagggca ccaccgttct gctggtcgaa cagaacgcca tgggggcgct ggccgtggcg       600
     gaacgcgggt acgtcctcga gaccgggcgc atcgtcctct cgggcagggc cgatgagctt       660
     atggagcacg acgatgtcca gagggcttac ctcggcaaag actacgaata caaatgggag       720
     aggtag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page