(data stored in ACNUC7421 zone)

EMBL: CP000478.PE38

CP000478.PE38        Location/Qualifiers
FT   CDS_pept        complement(53803..54669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0039"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein, putative"
FT                   /note="KEGG: dvu:DVU0978 ABC transporter, periplasmic
FT                   substrate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15742"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE90"
FT                   /protein_id="ABK15742.1"
FT                   /translation="MKALFFKAAVFSICLAIAGTGAVPSAGGEPCDGTYGSGPNRFVLA
FT                   TGSPGELGLVKALADVFTARTNTTLCWKKAGSGESLKMLKEKTADVIMGHSPDAEKKAV
FT                   AEGWAANHTLIGSNEFFIVGPATDPAGIANTSSAVEAYRKIAETKAKFFSRGDNSGTHK
FT                   KELQIWAKAGVTPSGDWYVVTKQFMIATLRMADSERGYFMTDSSTWVAEKKNLKNLKVL
FT                   LKGDKILVNVYHGLCQPPGSTPGAEWAAKFIAFVASDEGQNIIRGFGKDLHGEGLYNDA
FT                   AYAKQFE"
     atgaaagctc ttttcttcaa agcggcggtg ttctcgatct gcctggcgat tgcgggcacg        60
     ggtgcggtgc ctagcgccgg cggcgagccg tgcgacggca cctatggctc cggtccgaac       120
     cggtttgtgc tggcaaccgg aagcccgggg gagctcggat tggtcaaggc attggccgac       180
     gtgttcaccg cacggaccaa caccactctg tgctggaaga aggccggatc gggcgaatcc       240
     ctgaaaatgc tgaaggaaaa gacagccgac gtgatcatgg gacacagccc cgacgccgaa       300
     aaaaaagcgg tggcggaagg ctgggccgca aaccacacgc ttatcggctc gaatgagttc       360
     ttcatcgtcg gacctgcaac ggaccccgcg ggtatcgcga acacttcgtc agccgtcgag       420
     gcctatcgga aaattgcgga aaccaaggca aagttttttt cacggggaga caattccggc       480
     acgcacaaga aggaactcca gatttgggcc aaggcgggag tcaccccatc cggagactgg       540
     tacgtcgtga cgaagcagtt catgatcgca acgctcagga tggcggatag cgagcggggc       600
     tatttcatga cggacagcag cacctgggta gccgaaaaga agaacctgaa gaatctgaaa       660
     gtgcttctta agggggacaa gatcctggtc aacgtctacc acgggttgtg ccaaccgccg       720
     gggagcacac cgggcgccga atgggcggcc aaattcatcg ctttcgtcgc gtccgatgaa       780
     ggacagaaca tcatccgcgg ctttggaaaa gacctgcacg gagagggtct ctacaacgac       840
     gccgcatacg cgaagcaatt cgaatag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page