(data stored in ACNUC7421 zone)

EMBL: CP000478.PE383

CP000478.PE383       Location/Qualifiers
FT   CDS_pept        complement(463381..465231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0387"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: gme:Gmet_0948 indolepyruvate ferredoxin
FT                   oxidoreductase, alpha subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16087"
FT                   /db_xref="GOA:A0LF85"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF85"
FT                   /protein_id="ABK16087.1"
FT                   /translation="MTERSILLGNEAIALGLLEAECTMAASYPGTPASEILRALASLKE
FT                   RHKLDLHLEWSINEKAAFEVALANSYTGRRSATIMKQVGLNVAADPLMSAAYTGVKGGF
FT                   VLISADDPGPHSSQTEQDSRLIAMVAKIPVFDPSSPEEAREYARRACALSEKHEIPVML
FT                   RPTTRVCHARQDMDLRPVPHPKQFPLFEKNPGRWAATPKFRLVLHRQLNEKLARISRDP
FT                   DCAPQLVNGDALGPGTRDGGRACIVGSGVVTAHAQEILGELGLWDRVPFYRLPMPYPLP
FT                   ESFRDDLLSSYDRILILEETDPVIELQLQNREKIFGRTTGHVPTAGELLPEVVEGILRS
FT                   FLGLDPSPPVEPPAYPGRRPTLCAGCPHRAAFFAIKKAFPKGIYPGDIGCYTLGLNLGV
FT                   VDTVLCMGASINQAAGFYHAYRSARRDMPPICATIGDSTFFHAGVPALMNAVVQGARFV
FT                   LVVLDNSTTAMTGHQPTPALGRNLDGIPVPRLSIAELAKACGVRSVAEGDPYDFDRFLD
FT                   LLKAAGRHAGAEDGGVAVVIAKRPCLMDRNQPRTWPRLRIEVNEKCKGCDFCVKQFECP
FT                   ALRPRGEKEPIVIDDSLCSGCGVCVRVCPHGALEAVSEGH"
     ttgacggaac gcagcatatt attgggaaat gaagcgatcg cgctcggctt gctggaggcg        60
     gaatgcacga tggcggcgtc ctatcccgga acgcccgcct cggagatcct gcgcgccctt       120
     gcgagcctca aggaacggca caagctcgac ctccacctcg aatggtccat caacgaaaag       180
     gccgccttcg aagtggcgct cgccaacagt tacaccggca ggcgttccgc gacgatcatg       240
     aagcaggtgg gcctgaacgt cgccgcggac cctctcatga gcgcagctta taccggggtg       300
     aaaggcggtt tcgtcctcat ctccgccgac gacccggggc cgcacagctc ccagaccgag       360
     caggacagcc gtctcatcgc catggtggcg aaaatccccg tgtttgaccc gtcttccccg       420
     gaggaggccc gcgagtatgc ccgccgggcc tgtgccctgt ccgagaaaca tgaaatcccg       480
     gtcatgctgc ggccgaccac gagggtgtgc catgcccgcc aggacatgga cctccgcccg       540
     gtcccccacc cgaagcagtt tcctttgttc gagaagaatc ccggacgctg ggcggcgacg       600
     ccgaaattca ggctggtcct gcatcgtcag ctcaacgaga agctggcccg gatttcccgg       660
     gaccccgact gcgccccgca gctcgtgaac ggcgacgcgc tggggcccgg aacccgagac       720
     ggcgggcggg cctgcatcgt cggctcgggc gtggtcacgg cgcacgcgca ggagatcctg       780
     ggcgagctcg gcctctggga tcgggtgccg ttctaccgtc tgcccatgcc ctaccctctt       840
     cccgagtctt tccgggacga cctgctgtcg agctacgaca ggatactgat cctcgaggaa       900
     accgacccgg tcatcgaact gcagcttcag aaccgcgaga agattttcgg ccggacgacg       960
     ggccatgtgc cgaccgccgg ggagctgctg cccgaggtgg tggaaggtat tcttcggagt      1020
     ttcctgggtc ttgacccgtc gcctcccgtg gaaccgccgg catatccagg ccggcgcccc      1080
     accctgtgcg ccggatgccc tcaccgcgcc gccttctttg ccatcaagaa agctttcccg      1140
     aaggggatct acccgggcga catcggctgc tacacgctgg ggctcaacct gggcgtggtc      1200
     gacacggtgc tgtgcatggg agcctccatc aaccaggccg ccgggttcta ccacgcgtat      1260
     cgctcggcgc gccgggacat gccgccgatc tgcgccacca tcggggattc gacctttttt      1320
     cacgccgggg ttccggcctt gatgaacgcc gtcgtacagg gggcgcgctt cgtcctggtg      1380
     gtcctggaca acagcaccac ggccatgacc ggacaccagc ccacgcccgc gctgggacgg      1440
     aacctcgacg gcatcccggt cccgaggctt tccatcgcgg agcttgccaa agcgtgcggg      1500
     gtaaggtccg tcgccgaagg cgatccctat gatttcgacc ggttcctcga tctgctcaaa      1560
     gcggccgggc ggcatgccgg cgccgaggac gggggcgtgg ctgtggtgat cgccaagcgt      1620
     ccttgcctca tggaccggaa tcagccccgc acgtggccgc gcctgcggat cgaggtcaat      1680
     gaaaaatgca agggctgcga tttttgcgtc aagcagttcg aatgccccgc cctccgtccg      1740
     cgcggcgaaa aggaacccat cgtcattgat gacagcctgt gctcgggatg cggagtatgc      1800
     gtgcgggtat gtccccacgg ggcactcgag gcggtctccg agggacactg a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page