(data stored in ACNUC7421 zone)

EMBL: CP000478.PE386

CP000478.PE386       Location/Qualifiers
FT   CDS_pept        complement(469357..471522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0390"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: dvu:DVU3033 iron-sulfur
FT                   cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16090"
FT                   /db_xref="GOA:A0LF88"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF88"
FT                   /protein_id="ABK16090.1"
FT                   /translation="MITTPRNMKEYKAQVRRALKNRFLATTLENFAAAYPVSRANAFEG
FT                   IDVEALVEEIARSKDACIPYLEELYARFKTNAEAAGMKVHRARTALEANALIAGIARES
FT                   GVTRIVKGKSMTAEETFLNDRLEKDGFKVTETDLGEWIIQLRGEGPSHMVMPAIHLSRR
FT                   EVAELFRRVTGRPMDPDDIDGMVKVARRELRQAFLEADMGISGANFAIADSGTIGLVTN
FT                   EGNGRLVTTLPRVHVALVGFDKLVPDLESALRILRALPRNATGQVISTYVTWITGAVEC
FT                   PPAPGGRKETHIVFLDNGRLALARDPLFAEALRCIRCGACANVCPIYKLIGGHNYGHVY
FT                   IGAIGLILTFFYHGRENARTIVRNCLNCQACKAVCAAGIDLPRLIKEVYGKILRIEGGK
FT                   PLKNRLLGRVLKDRPLFHFLLRRAYLAQQPLTRGRPMLRHLPLFFSGEHGFRSLPAIVA
FT                   TPLRDRWEKINPPVPNPRLRVGLFGGCLVDFAYPEQAEALIRLLEGRRIRLEYPMGQTC
FT                   CGLPAKMTAEDETARRVAAQNLRAMDPDRYDHILTLCASCGSHLRENYPRLLASDARMS
FT                   AKARQFAARVIDFSSFMIHVLHVEPGSFQGGGRKVAYHSPCHLCRGLGVTREPRELLAA
FT                   AGFEYVRCKDEDVCCGFGGSYSLDFPMISAELLKRKLDIVTSSGAELLVTDCPGCVLQL
FT                   RGGMDKREGPKVEVKHIAEAVADARKS"
     atgatcacca caccccggaa tatgaaagaa tacaaggcgc aggtgcggcg cgcgctgaag        60
     aaccggttcc tcgcgaccac cctggagaat ttcgccgcgg cctaccccgt ttcccgcgcc       120
     aacgccttcg aaggaatcga cgtggaggca ctggtcgagg aaatcgcccg gtccaaggac       180
     gcgtgcatac cttacctcga ggagctctac gcccggttca agacgaacgc cgaagcggcg       240
     ggcatgaaag tgcaccgggc gcgcacggcg ctcgaggcca acgcgctcat cgccggcatc       300
     gcgcgggaga gcggcgtgac ccggatcgtc aaaggcaagt ccatgaccgc cgaagagacc       360
     ttcctcaacg atcgcctgga aaaagacggg ttcaaggtga cggagacgga cctgggcgaa       420
     tggatcatcc agcttcgcgg ggagggcccg tcgcacatgg tcatgccggc cattcacctg       480
     tcgcgccgcg aggtcgccga actgtttcgg cgcgtgacgg gacgtccgat ggacccggac       540
     gacatcgacg gcatggtcaa agtggcccgt cgcgagttga gacaggcttt cctcgaggcg       600
     gacatgggca tcagcggggc caacttcgcc atcgccgatt cgggcaccat cggcctggtc       660
     accaacgaag gcaacgggcg cctggtgacg actctgcccc gcgtacacgt ggctctggtc       720
     gggtttgaca aactggtgcc ggacctcgaa tccgccctgc gcatcctccg ggctctgccg       780
     cgcaacgcca cgggacaggt catttcgacc tacgtcacgt ggatcaccgg cgccgtggaa       840
     tgccctccgg cgccgggagg ccggaaggaa acgcacatcg tctttctcga caacggcagg       900
     ctcgccctgg cccgggatcc cctgttcgcc gaagcgctcc ggtgtatccg gtgcggcgcc       960
     tgtgcgaacg tatgccccat ctacaagctg atcggaggcc acaactacgg gcacgtttac      1020
     attggggcca tcgggctgat tctgaccttt ttctatcacg ggcgggagaa cgcccgcacc      1080
     attgtccgga actgcctgaa ctgccaggcc tgcaaggcgg tctgcgcggc cgggatcgac      1140
     ctgccccggc tgatcaagga agtgtacgga aagatacttc ggatcgaggg cggcaaaccg      1200
     ctgaagaaca ggcttctcgg ccgggtgctc aaagatcgcc cgctgttcca ttttctcctg      1260
     cgtcgagcct acctcgctca gcagccgctg actcgcggcc ggcccatgct gagacacctg      1320
     cccttgttct tttccgggga acacggcttc cgcagtctgc cggccattgt cgcgacgcct      1380
     ctcagggacc ggtgggaaaa gatcaacccg cccgtgccga acccccgcct ccgggtgggg      1440
     cttttcgggg gatgcctggt ggatttcgcc tatccggaac aggccgaggc gcttatccgt      1500
     ctgctcgaag gccgtcgaat ccggctcgaa taccccatgg gccagacctg ttgcggcctg      1560
     cccgcaaaga tgacggcaga agacgaaacc gcgcgccggg tggccgcgca aaacctgcgg      1620
     gccatggacc cggaccgtta cgaccacatc ctgacgctgt gcgcctcgtg cggctcgcac      1680
     ctgcgcgaga actacccgag gcttctggcg tcggacgcgc ggatgtcagc gaaggcccgg      1740
     caatttgcgg ccagggtgat cgatttcagc tccttcatga tccatgtcct ccatgtcgaa      1800
     cccgggtcgt tccagggcgg agggcgcaag gtcgcctacc attccccgtg ccatttgtgc      1860
     cgagggctgg gtgtgacccg cgaaccccgg gaactgctcg ccgctgccgg cttcgagtac      1920
     gtccggtgca aggacgagga cgtgtgctgc ggcttcggcg ggtcgtattc cctggatttc      1980
     ccgatgatct cggccgagtt gctgaaacgc aagctcgata tcgtgacgag cagcggcgcg      2040
     gagctgctgg tcaccgactg cccgggttgc gtcctgcaac ttcgcggcgg gatggacaaa      2100
     cgggaagggc cgaaggtcga ggtgaaacac atcgccgaag ccgtggccga cgcccgaaaa      2160
     agttga                                                                 2166
//

If you have problems or comments...

PBIL Back to PBIL home page