(data stored in ACNUC7421 zone)

EMBL: CP000478.PE388

CP000478.PE388       Location/Qualifiers
FT   CDS_pept        472346..473728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0392"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   dde:Dde_3239 glycolate oxidase, subunit GlcD"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16092"
FT                   /db_xref="GOA:A0LF90"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF90"
FT                   /protein_id="ABK16092.1"
FT                   /translation="MIGRALIAEFEKLLGRDNVFADEADRHTYSYDAAVLDPVLPALVV
FT                   RPTSSEGLGRSVRLCGENALPVTVRGAGTNLSGGTIPARGGVVIVTNGLNRILEINEAD
FT                   LYAVVEPGVVTARFAAAVESRGLFYPPDPGSQAVSTLGGNVAENAGGLRGLKYGVTGDY
FT                   VLGLSFFDANGEIVKTGARTVKCVAGYNLAGLMVGSEGTLGVFDRIILKLIPIPAARKA
FT                   MLAVFDDIAKACEAVSGIIADKIVPATLELMDNFTIRAVEDYGHAGLPVDAAALLLIEV
FT                   DGHAAQVEEDASRVEAVCRGRGAMSLRVARTAAERDKVWEARRAALSALAKLKPTVVLE
FT                   DATVPRSKIPAMMNSLEAIASRYRLTIGTFGHAGDGNLHPTILTDRRDRAEWSRVEAAI
FT                   DAIFDEALKLGGTLSGEHGIGLAKSRFLEKETSRATILYSRRIKTALDPKNILNPGKII
FT                   GE"
     atgataggcc gtgccttgat cgccgaattc gaaaagctgt tgggcaggga caatgtattc        60
     gccgacgaag cggaccggca tacctattcc tacgatgccg ccgtcctcga cccggtcctt       120
     cccgccctgg tggtgagacc gacctccagc gagggcctcg ggcgctcggt gcgcctttgc       180
     ggcgaaaacg ctctgcctgt caccgtgcgg ggcgccggca ccaacctgag cggcgggacg       240
     atcccggccc gcggcggggt cgtgatcgtg accaacggtc tgaaccggat cctcgaaatc       300
     aatgaagccg atctttacgc cgtggtcgag cccggcgtgg ttacggccag gttcgctgcg       360
     gcggtggaat cccgggggct gttctacccg cccgaccccg gcagccaggc ggtatcgacc       420
     ctgggcggga acgtcgcgga gaacgcgggt ggattgaggg ggctgaaata cggggtgacc       480
     ggcgattacg tgctggggct cagctttttt gacgccaacg gtgaaatcgt gaagaccggg       540
     gcgcgcacgg tcaagtgcgt cgccggctac aacctggccg ggctcatggt ggggtccgag       600
     gggacgctgg gagtgttcga ccgtatcatt ttgaaactca taccgatccc tgcggcccgg       660
     aaggccatgc tggccgtttt cgacgatatc gccaaggcct gcgaggccgt gtccggcatt       720
     atcgccgaca agatcgtccc cgccaccctc gagctcatgg acaacttcac catccgcgcg       780
     gtggaggact acggtcatgc gggacttccc gtggacgccg cggctctgct gttgatcgaa       840
     gtggacgggc acgcggccca ggtggaagag gacgcctcca gggttgaagc cgtctgccgc       900
     ggccgggggg ccatgtcctt gcgtgttgcc cgcaccgccg ccgaacggga caaggtctgg       960
     gaggcgcgcc gcgccgccct ctcggccctg gccaagctga agccgaccgt ggtcctggag      1020
     gacgccacgg tgccgcgcag caagatcccg gcaatgatga acagcctgga ggccatcgcc      1080
     tcgcgctacc gcttgaccat cgggacgttc ggccacgcgg gcgacggcaa cctgcacccg      1140
     accatcctca ccgaccgccg cgaccgggcg gaatggagtc gcgtggaagc cgccatcgac      1200
     gcgatcttcg atgaggctct caagctcggc gggacgctct cgggcgaaca cggcatcggc      1260
     ctcgccaagt cccgcttcct ggaaaaggag accagccggg cgaccatcct gtattcgcgc      1320
     cgcatcaaga cagcactgga tccgaaaaac attctgaatc ccggcaagat cattggagaa      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page