(data stored in ACNUC7421 zone)

EMBL: CP000478.PE39

CP000478.PE39        Location/Qualifiers
FT   CDS_pept        55042..55374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15743"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE91"
FT                   /protein_id="ABK15743.1"
FT                   /translation="MKQYVIDQLRGPDYERIRDYLDANAEKTFMEDMYWVNLPPGLYSA
FT                   VQKEHESCHPFYFAVNLSPTQVDFEFLIRSRQIIRCSCIAYATAKQRDYIMDYADEMIR
FT                   RLDMKI"
     atgaaacaat atgtgatcga tcaattgcgc gggcccgact acgaacggat tcgggactat        60
     ctggacgcca atgccgaaaa aacgttcatg gaagacatgt actgggtgaa tcttcccccc       120
     gggttgtact ccgccgtgca aaaggagcac gaaagctgtc acccgtttta ttttgccgtc       180
     aacctgtctc ctacccaggt ggacttcgag ttcctgatcc gcagccgcca gatcattcgc       240
     tgcagttgca tcgcttacgc gacggcgaag cagagggact acatcatgga ttacgccgac       300
     gagatgatcc ggcggctgga catgaaaata tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page