(data stored in ACNUC7421 zone)

EMBL: CP000478.PE394

CP000478.PE394       Location/Qualifiers
FT   CDS_pept        complement(480646..481314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0398"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: tfu:Tfu_2783
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16098"
FT                   /db_xref="GOA:A0LF96"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF96"
FT                   /protein_id="ABK16098.1"
FT                   /translation="MRPRPSIRVQMKPISPKFVTFEGIDGCGKSTLIDELASWLDRTRV
FT                   PYVKTREPGGTSLGEKIRGLLLDPAHRGMNRQTEVLLYTASRAQLVAEIILPALKSGAW
FT                   VLADRYIDATLAYQGYGRELDPDPLRRLQHWATQALVPDKTVLLDCGIDTAAARMSARN
FT                   HRPDRIEMEERAFHERVKAGYLDLASLDPGRFIVLDAEKPLPEVIADFRAAFREIVPAP
FT                   "
     atgcgtccgc gaccctcaat tcgagtgcag atgaaaccca tatccccgaa attcgtgacg        60
     tttgaaggca tcgacggctg cggcaagagt actctcatcg atgagctcgc atcctggctg       120
     gaccggaccc gggtccctta tgtgaagacc cgcgaacccg gcggaacgtc gctgggggag       180
     aagatacgcg ggctgctgct cgatcccgcc caccggggca tgaaccggca aaccgaagtc       240
     cttctctaca ccgccagccg cgcccaactc gttgcagaga tcatcctgcc cgcactgaaa       300
     agcggcgcgt gggtgctcgc ggaccgatac atcgacgcca ccctcgccta ccagggctac       360
     ggccgggaac tggacccgga cccgctccgg cgccttcagc actgggccac gcaggctctc       420
     gtgccggata aaaccgtgct tctcgattgc ggaatcgata cggcggcggc tcgcatgtcg       480
     gccaggaacc acaggccgga ccggattgaa atggaggagc gggcttttca tgaacgggtg       540
     aaggcgggct acctcgatct ggcttccctc gatccggggc gattcatcgt gctcgatgcc       600
     gagaagccgc tccccgaggt gatcgccgat ttcagagccg cctttcgcga aatcgtgccg       660
     gctccgtaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page