(data stored in ACNUC7421 zone)

EMBL: CP000478.PE397

CP000478.PE397       Location/Qualifiers
FT   CDS_pept        483482..484270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0401"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cps:CPS_4536 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16101"
FT                   /db_xref="GOA:A0LF99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF99"
FT                   /protein_id="ABK16101.1"
FT                   /translation="MIRIERLRKSYDGLVASDDVSCRFEKGKITVILGGSGSGKSTLLK
FT                   QLVGLERPDSGKIFFEDRELTGLSRSELYEIRKKMGMLFQGAALFNSLNVFENIAFPLR
FT                   EHTRLAEPVIRAMVTMKLEMVGLRGMEQLMPSQLSGGMAKRIGLARAIVMDPRAVFYDE
FT                   PTSGLDPISAGVINKLIVDLNTAMGVTSVVVSHDIPSSFRIAHRIIILFFGRKIAEGTP
FT                   EEIRGSEDARVLQFIRGEPEGPIPFNRTEKNYYDDILRVP"
     atgatcagaa tcgaacggct gcgcaaaagc tatgacgggc ttgtcgcgtc cgacgatgtg        60
     tcgtgccgtt tcgaaaaagg caaaatcacg gtcattctcg ggggaagcgg ttcgggaaag       120
     tcgaccttgc tcaaacaatt ggttgggctg gaacgtcccg attccgggaa gatatttttc       180
     gaggatcgcg aattgaccgg attgtcgaga agcgagctct acgaaatacg aaagaagatg       240
     ggcatgctgt tccagggggc cgccctgttc aattccctca acgttttcga gaacatcgca       300
     tttccgcttc gcgagcacac ccgcctggcg gaaccggtca ttcgagccat ggtcacgatg       360
     aagctggaga tggtcggtct gcgcgggatg gaacagctca tgccgtcgca gctttcggga       420
     gggatggcga agcggatagg acttgcccgg gccatcgtca tggaccccag ggcggttttt       480
     tacgacgagc ccacatccgg tctcgatccc atatcggcgg gcgtgatcaa caagctcatc       540
     gtggatctga acaccgccat gggggtgacg tccgtggtcg tgtcgcacga tattccttcc       600
     tctttccgga tcgcgcaccg aatcatcatt ctgttttttg gcaggaagat cgcggaaggg       660
     acccccgagg aaatccgggg cagcgaagac gccagggtgt tgcagttcat ccgcggggag       720
     cccgaggggc cgatcccttt caaccgcacc gaaaagaatt actacgacga cattctgagg       780
     gtcccatga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page