(data stored in ACNUC7421 zone)

EMBL: CP000478.PE4

CP000478.PE4         Location/Qualifiers
FT   CDS_pept        3935..4657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15708"
FT                   /db_xref="InterPro:IPR016936"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE56"
FT                   /protein_id="ABK15708.1"
FT                   /translation="MTFVDTMINLMENELHGRVLGWRPNDIIVGRFTDNINNYQLGVLE
FT                   AIRFTTLRLKDSLTRMGDADTYDPDLEYALNLFMIRATSFWFPTAEGEYDKAIEHLRNF
FT                   RAKLEKGQRTFYYRKDNLISLLSVYKDLLGNVNKTLVVSPISWFQADDSFYYAKGVAHV
FT                   CYEILRVVRVGYQKQLASTMYGIEMMDTIVHELYRVENIDPWLILDSDLGSLLANHRAN
FT                   INAPLSEATHLMGILALL"
     gtgactttcg tggacaccat gatcaacctg atggaaaacg agctccacgg gcgtgttctt        60
     ggctggcgtc ccaacgatat catcgtcggc cgcttcacgg acaacatcaa caactaccag       120
     ttgggggtcc tggaggcgat ccggttcacc accctgcgtc tgaaagacag cctgacgcgc       180
     atgggcgacg ccgataccta cgatcccgac ctcgaatatg cgttgaacct gttcatgatc       240
     cgggcgacct ccttctggtt tccgaccgcg gaaggggaat acgacaaggc catcgaacat       300
     ctccggaact tccgggccaa gctggaaaag ggccagcgca ccttttacta tcgcaaggac       360
     aacctcattt cgctgctgtc cgtgtacaag gacctcctgg gcaacgtgaa caagactctg       420
     gtcgtttctc ccatcagctg gttccaggcc gatgattcgt tttactacgc caagggcgtg       480
     gcccacgtgt gctacgagat cctccgggtc gtacgggtcg gttaccagaa acagctggct       540
     tcgaccatgt acggcatcga gatgatggac acgatcgtgc atgagctcta ccgggttgag       600
     aatatagatc cgtggctcat tcttgacagc gacctcggca gtctcctcgc caaccatcgc       660
     gccaacatca acgcgccgct cagcgaggcg acccacctga tgggtatcct cgctctgctg       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page