(data stored in ACNUC7421 zone)

EMBL: CP000478.PE400

CP000478.PE400       Location/Qualifiers
FT   CDS_pept        485788..486393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0404"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   gme:Gmet_0784 toluene tolerance"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16104"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA2"
FT                   /protein_id="ABK16104.1"
FT                   /translation="MVGKMVIALLLAASLFIAAPASAGEPMEQLRVSVEKVVEILKDPS
FT                   LKSPDRMLERRNRIFKVVEERFDFSEMAKRCLGEFWPKISEAEQREFEVAFASLLETSY
FT                   IATIERFDEESVVFEEERPKGRQYFVVHTAVVSGGRSISVDYSVRNVNGQWLVYDVNIE
FT                   EVSLVAGYRVRFAETFRREGFRGLMKKIAEEAGGPGKG"
     atggtcggga aaatggtgat tgctttgctt ttggcggcgt cgctcttcat tgccgcgccg        60
     gcttcggccg gtgaaccgat ggagcagttg cgggtttccg tcgagaaagt cgtcgagatc       120
     ctgaaggatc cgagcctcaa atcgccggat cggatgctgg agcggcgcaa caggatattc       180
     aaagtggtgg aggagcgctt cgatttttcg gaaatggcga agcgctgcct gggcgagttc       240
     tggccgaaga tttcggaggc ggagcagcgg gagttcgagg tggccttcgc gagcctgctg       300
     gagacttcct acatcgcgac gatcgagcgg ttcgacgagg aatccgtcgt gttcgaagag       360
     gaaagaccga agggcaggca gtacttcgtg gtgcacaccg ccgtggtctc cggcgggcgt       420
     tcgatctccg tcgactattc cgtgcgaaat gtgaatggac agtggctggt ctacgacgtt       480
     aacattgaag aagtctcgct ggtggccggc tatcgggtcc gtttcgcgga gacgtttcgc       540
     agggaagggt tccgcgggct gatgaagaag atcgccgagg aagccggggg tccgggaaaa       600
     ggctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page