(data stored in ACNUC7421 zone)

EMBL: CP000478.PE402

CP000478.PE402       Location/Qualifiers
FT   CDS_pept        487330..488166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0406"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; Rubrerythrin; KEGG:
FT                   dvu:DVU1973 rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16106"
FT                   /db_xref="GOA:A0LFA4"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA4"
FT                   /protein_id="ABK16106.1"
FT                   /translation="MTAGSGSGDVKSLYPDEAKEFIDEHKEGTYLLLDVRQPTEYEQGH
FT                   LPGAQLIPLPSLPDSIGGLDRKRPVLVYCAVGGRSATAASFLAHHGFSEVYQLLGGIQA
FT                   WEQPTAANPVKFHLEFASGRESPREAVLLAYAMEQGMLDFHEAVRVRTTEPDLADLLVK
FT                   LVRAEESHKKTLRELLRQHAPDEPPPEDVPGGSSRIMEGGLDIQDFMKQNESFMKTTAG
FT                   YLDIAMMVESQALDLYLRMGAASSNEKTRRILFHIADEEKAHLSMLAELLEKKMSA"
     atgacggcgg gaagcggttc cggggacgtg aagtcactct acccggatga ggccaaggaa        60
     ttcatcgacg aacacaaaga gggcacttac ctcctcctcg atgtgcggca accgaccgag       120
     tacgaacagg gacacctgcc cggggcgcaa ttgatccctt tgccgagtct gcccgactcc       180
     atcggggggc tcgaccggaa gaggcccgtc ctggtctact gcgccgtggg aggccgcagc       240
     gcgacggccg cttcctttct cgctcaccat gggttttcgg aagtctacca gttgctgggc       300
     ggtatccagg cgtgggagca gcccaccgcg gccaacccgg tcaaattcca cctggagttc       360
     gcaagcggtc gcgaatcccc gcgggaagcg gtgttgctcg cctacgccat ggaacagggc       420
     atgctggatt tccacgaggc ggtcagagtg cggaccacgg agccggacct ggccgacctg       480
     ctggtgaagc tggtgcgggc cgaagaaagc cacaagaaga cgctgcgcga gctgctgcga       540
     cagcatgccc cggatgagcc accgcccgag gatgtgcccg ggggctcgtc gcggatcatg       600
     gaaggcggat tggacattca ggacttcatg aagcaaaacg agtccttcat gaagaccacg       660
     gcggggtacc tcgacatcgc gatgatggtg gaaagccagg ccctcgatct ctacctgcgg       720
     atgggggcgg cgagctccaa cgagaagacg cggcgcattc tctttcacat cgccgacgag       780
     gaaaaggcgc acctgtccat gctggccgag ctgctcgaga agaagatgag cgcgtga          837
//

If you have problems or comments...

PBIL Back to PBIL home page