(data stored in ACNUC7421 zone)

EMBL: CP000478.PE404

CP000478.PE404       Location/Qualifiers
FT   CDS_pept        complement(489220..490572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0898 cellulose-binding, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16108"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013431"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA6"
FT                   /protein_id="ABK16108.1"
FT                   /translation="MRQSERANPYLGTIAAALFVFSVLCCGAARAGGTDEGRAILVDAH
FT                   GNVYVCAKSWRSSDQQFGIVTMKYSSSGKRLWARRFTDINNNGTWGQGSVALDGNGNFY
FT                   LTGQTLDRKLLVLKYTPAGSPVVSKYSFGGIPVGSGSNGRAIHVTPDGKGIYVTGEYWN
FT                   SSNSTWDIVTARLGPDPDMEWTTRRIASKHQFARAMVVGTNGNVTVTGQNFDAEADTYD
FT                   YLTIKYNALGKIEWAKTYNKGTWDEPFSVAVDPGGNAIVTGSAGSAEATRDFVTVKYSP
FT                   GGVQSPAWIYDGAAHALDYAETVKTDANGNVYVAGTSSGAYNWDIVLLKYNSSGQKVWT
FT                   RSYSNLCNDFFDEMALDKNGNIYVAGHSGSGGSGTWDYLTMKYNPNGKRAWTKFFNSSH
FT                   NSADMALSLTVDGSANVYVTGKSYNGTDYDCLTVKYDTNGNLVWSRRYDSA"
     atgagacagt cggaacgagc taatccgtac ctgggtacga ttgcggccgc gctgttcgtc        60
     ttttccgttc tttgctgcgg agccgcccgg gcgggcggca cggacgaggg cagagcgata       120
     ctcgtcgacg cgcatggcaa cgtctatgtt tgcgccaagt cgtggcgaag cagcgatcag       180
     caattcggca ttgtcacgat gaagtactcc tcctccggca agagactctg ggcaaggcgc       240
     ttcacggaca tcaacaacaa cggaacctgg ggtcagggca gcgtcgcgtt ggatggaaac       300
     ggcaacttct acctcaccgg acagaccctg gatcgtaaat tactggttct caagtatacg       360
     ccggccggat cgccggtcgt atccaaatac agttttggcg gcatcccggt gggaagcgga       420
     agcaacggaa gagccatcca cgtcacgccc gacggcaagg gtatttacgt caccggtgaa       480
     tactggaact ccagcaactc cacgtgggac attgtgacgg caaggctcgg gccggacccc       540
     gacatggagt ggacgacacg cagaattgcg tcgaagcacc agttcgcccg ggccatggtg       600
     gtgggtacga acggcaacgt cactgtcacc gggcaaaatt tcgacgccga ggccgacacg       660
     tatgactacc tcacgatcaa gtacaacgcc ctgggaaaga ttgagtgggc caagacgtac       720
     aataagggca cgtgggacga acctttttcc gtggcggtgg accccggcgg gaatgccatt       780
     gtgacgggat cggccggcag cgcggaagcg acacgggact tcgtgaccgt gaagtattcg       840
     cccgggggtg tccagtcccc cgcatggatt tatgacgggg cggctcacgc gctcgattac       900
     gccgagaccg tcaagaccga tgcgaacggc aacgtctatg tggccgggac ttcatccggc       960
     gcctacaact gggacatcgt cctgctgaaa tacaactcgt cgggtcagaa ggtctggact      1020
     cgaagctaca gcaacctctg caatgacttt ttcgacgaaa tggccctgga taagaacggc      1080
     aatatttacg tggccggaca ttccggatcg ggaggttcag ggacctggga ctacctcacc      1140
     atgaaataca acccgaacgg aaagagggct tggacgaagt ttttcaacag cagccacaac      1200
     agcgccgaca tggcgctttc actcaccgtg gacgggagcg ccaatgtgta cgtgaccggc      1260
     aaatcgtaca acgggacgga ctacgattgc ctcaccgtca agtacgatac caatggaaac      1320
     ctggtctggt ccaggcgcta cgattcggcg tag                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page