(data stored in ACNUC7421 zone)

EMBL: CP000478.PE405

CP000478.PE405       Location/Qualifiers
FT   CDS_pept        complement(491264..491563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0409"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: pfu:PF0573
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16109"
FT                   /db_xref="GOA:A0LFA7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA7"
FT                   /protein_id="ABK16109.1"
FT                   /translation="MPLVRVIRNGQITIPKKLRATLGIEEGDLLEVKLSQGGMTIKPKT
FT                   AVDKELSKGRFFRMVEEIRESVKDADPREVDAALAEAVRAAGKATSKKMKPRRS"
     atgccgctgg tcagagtgat cagaaacgga caaatcacga tccccaagaa gttgcgggcc        60
     actttgggca ttgaagaagg ggatcttttg gaagtgaaac tgagccaagg aggaatgacc       120
     atcaagccta aaaccgccgt ggacaaggaa ctctccaaag ggcggttctt tcggatggtg       180
     gaggaaatcc gggaaagcgt caaggacgcc gatccccggg aggtggatgc ggcgctggct       240
     gaagcagtgc gggccgccgg gaaagccacg agcaaaaaga tgaagccccg acgctcatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page