(data stored in ACNUC7421 zone)

EMBL: CP000478.PE406

CP000478.PE406       Location/Qualifiers
FT   CDS_pept        complement(492634..496077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bth:BT4627 DNA modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16110"
FT                   /db_xref="GOA:A0LFA8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR025931"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA8"
FT                   /protein_id="ABK16110.1"
FT                   /translation="MDKQQARKLIKQTFEQPFEKTRFTTLIKNLLNRCEEAPLSYKGQY
FT                   IPDAYKPYISALDRIGKFHDGEHAVDILVIKLKKETSLERARTMQRNFVAWYLNGSRGD
FT                   KLKDAALVAFVSPEETDWRFSLVKMDYRFEQTKTGKMKVKEEFTPARRWSFLVGTNEQS
FT                   HTAQSRLINLLANDEQTPTLAELEEAFNIETVTTEFFLKYRDLFIRTKEALDRVVRGDP
FT                   RIEAEFEAKQVNTVDFAKKLLGQIVFLYFLQKKGWFGVGRDAPWGTGSRQFLRELFEQK
FT                   HGRYGNFFDDILEPLFYEALRNDRSHDDDYYSRFNCKIPFLNGGLFDPIDDYDWVHTNI
FT                   NLPDSLFSNQNRTAEGDIGDGILDIFDRYNFTVKEDEPLEKEVAIDPELLGKAYEKFNA
FT                   IRPDNFEEYKQVLRSGKKGDENKFNKQFGVYYTPREIVHYMCRQSLINYLHTELGKDIV
FT                   THKKLFEKQTTMFGNQAKRGQLDCTIEYKLTPQISRKDIETLIHLGEQVSANEARVENK
FT                   GKETVTYSYKLPESIRKNAGPIDRKLADITVCDPAVGSGAFPVGMMTEIVRTRNVLSTF
FT                   IQEDKPTPYDLKRRCIEHSLYGVDIDAGAVEIAKLRLWLSLIVDEDDIKNIKPLPNLEY
FT                   KIVCGDSLLGYPYKPMGLDEVEKLKEQFLEEVNPKRKKELRNRIDAAIYGLFKNTEKSL
FT                   GYQVTMDFRTNFSEVFRTKGGFDVVVANPPYVRQEAIRHLKPKFKKIFKDFYCGTADIY
FT                   TYFYKCGVDLLKSNGHLCFIAPNKFMRASYGKNTRTLLTTRATPRLVIDFGDLPIFDAT
FT                   TYPSILLIEKRKPDGRDKAVTATFTDASQLAKLEDSLLDIAFLMPVKALSKEGWNLERS
FT                   DVLSLMEKLKKIGVPLGEYIQGRFYRGVLTGLNKAFVIDAATRERLIAEDPASADVIKP
FT                   WLRGRDIRKWKAEWAGLYVINIASSSNKTWPWSNVKTEAEAVRQFEETYPAIYRHLAPW
FT                   EKELQKRDDQGKFWWELRSCAYYEAFEGTKIIYPDISQASKFSWDQSNSYLGNTVYMIP
FT                   TDKLWLVGLLNSKFIWWYYSNITSTIRGGFVRFFSQYMETIPISLISDSQKTSIIERTR
FT                   AILAAPGSPAVPTLEAEIDQIVYVLYNLTPEEIRIVEGVN"
     atggataagc aacaggcacg caaactcatc aagcaaacat ttgagcagcc gtttgagaag        60
     acgcgcttta ccacgctgat caaaaatctt ctcaatcgct gtgaggaagc gccactttcc       120
     tacaaggggc agtacatccc ggatgcctac aagccttata tcagtgccct ggatcgtatc       180
     ggcaaattcc acgacgggga gcacgccgtt gatattctgg tgatcaagct caagaaggaa       240
     acctcgctgg aacgcgcccg caccatgcag cggaatttcg tcgcctggta cctcaacggc       300
     agccgcggcg acaagctgaa agacgcggca ctggtcgcgt tcgtctcccc ggaggaaacc       360
     gactggcgtt tttcgctggt gaagatggat taccggtttg aacagacgaa aaccggcaag       420
     atgaaggtga aggaagagtt caccccggcc cggcgctggt ccttcctggt gggcaccaac       480
     gaacaaagcc ataccgccca gagtcgactg atcaatctac tggccaatga cgaacagaca       540
     ccgacgctgg ccgagttgga agaagccttc aacatcgaaa ccgtcactac ggagttcttt       600
     ctcaaatacc gcgacctgtt catccggacc aaggaagcgc tggaccgggt ggtgcggggc       660
     gatcccagga tcgaggcgga attcgaggcc aagcaggtga acacggtgga cttcgccaaa       720
     aagctcctgg gacagattgt cttcctctac ttcctgcaaa agaaaggctg gttcggagtg       780
     ggccgagatg ccccctgggg aaccggttcg agacaattcc tgcgcgagct ctttgagcaa       840
     aagcacggcc gttacggtaa tttcttcgac gatatcctgg aacctctttt ttatgaagcg       900
     ctgcgcaacg accgcagcca cgatgatgat tactacagcc ggttcaactg caaaattccg       960
     ttcctcaacg gtgggctgtt cgatcccatt gacgattacg attgggtcca caccaacatc      1020
     aacctgcccg acagcctctt ttccaaccag aaccggaccg ccgaaggcga catcggcgat      1080
     ggaatcctgg acattttcga tcgttacaat ttcaccgtca aagaagatga gccgctggaa      1140
     aaagaagtcg ccatcgatcc ggaactgttg ggcaaagcat acgaaaagtt caacgccatt      1200
     cggccggaca actttgaaga gtacaaacag gttttaagaa gcggcaagaa gggggatgag      1260
     aacaaattca acaagcagtt cggcgtctac tacacgcccc gcgagatcgt ccactacatg      1320
     tgccggcaga gcctgatcaa ttacctgcac accgaattgg gcaaggacat agtcacacac      1380
     aaaaagctgt ttgaaaaaca gaccacgatg ttcgggaatc aagcgaaaag gggccaactg      1440
     gactgcacca tcgagtacaa gctgacgccg cagatttcca ggaaagacat cgaaaccctg      1500
     atccacctgg gcgaacaggt cagtgccaat gaggcgcggg tggaaaacaa gggcaaggag      1560
     accgtcacct attcttacaa gctgccggaa agcatccgca agaacgcagg gccgatcgac      1620
     cggaagctgg cggatatcac ggtgtgtgat ccggcggtgg gctccggtgc ttttcccgtg      1680
     ggcatgatga cggagattgt tcgaacccga aacgtgctgt ccacctttat tcaggaagac      1740
     aagccaaccc cgtatgacct gaagcgtcgc tgtatcgagc attccctgta cggcgtggat      1800
     attgacgccg gtgccgttga gattgccaag ctgcggctgt ggctctcgct gatcgtcgat      1860
     gaggacgata tcaagaatat caagccgctg cccaatctgg aatacaagat cgtctgtgga      1920
     gactcgcttc tcgggtatcc ctacaagcca atgggacttg atgaagttga aaaactcaaa      1980
     gagcagttcc tggaggaagt caatccaaaa cggaagaagg aattgagaaa ccgcatcgat      2040
     gcagcaatct atgggttgtt caagaatacc gaaaagagcc tcggatacca agtcaccatg      2100
     gatttcagga ctaacttttc cgaggtgttt cgaacaaaag gtggattcga tgtagtggtg      2160
     gccaatcccc cctacgtacg acaggaggcg attcgacacc tcaagcccaa gtttaaaaaa      2220
     attttcaagg atttctattg tggtacggcg gatatctata cgtatttcta taaatgcggc      2280
     gtcgacctgc tgaaatccaa cgggcatctc tgcttcatcg ctcccaacaa gttcatgcgg      2340
     gccagttacg gaaagaatac ccgcaccctg ctgaccaccc gggcaacccc gaggctggtc      2400
     atcgattttg gagacctgcc gatctttgat gccacaacct atccgtccat cctgctgatt      2460
     gaaaagcgga aaccggatgg gcgggataaa gccgttacgg ctacctttac cgatgcgtcc      2520
     cagcttgcaa agctggaaga tagcctcttg gacatcgctt tcctcatgcc tgtgaaagcc      2580
     ctcagcaaag aaggttggaa tttggagcgc tcggatgtct tgtcattaat ggagaagctg      2640
     aagaaaatag gcgtcccatt gggtgagtac atccaaggac gattctatcg gggggtactg      2700
     acaggtttga ataaagcctt tgtcattgac gccgccacgc gtgaaaggtt gattgccgaa      2760
     gatccggcca gtgccgacgt tatcaagcct tggctccgtg gccgcgacat tcgcaagtgg      2820
     aaggcggaat gggcgggatt gtatgtcatc aatatcgcga gcagttccaa caaaacatgg      2880
     ccatggtcga atgtaaaaac agaagctgag gctgttcgcc agttcgaaga gacgtatccg      2940
     gcgatttacc ggcatttagc accgtgggaa aaagagttgc agaagcgtga cgatcagggg      3000
     aaattctggt gggaactcag gtcatgtgcc tactatgagg catttgaagg aaccaagatc      3060
     atctatcctg atatttcaca agcatcgaag tttagctggg atcaaagcaa ttcatatctt      3120
     ggcaacacgg tttacatgat cccaacggac aagctctggc ttgtagggct cctgaactca      3180
     aaatttatct ggtggtatta ctccaatatc acttcaacta ttcgcggcgg ctttgtccgt      3240
     tttttcagcc agtatatgga aactatccca atttcgctaa tttccgatag ccaaaaaacc      3300
     tctataatcg aacgcactcg tgccattctt gctgcccctg gcagccctgc ggttcccacg      3360
     ctcgaagcgg aaattgatca aattgtctat gtcctttaca acctgactcc cgaggagatt      3420
     cgaattgtgg aaggggtgaa ttaa                                             3444
//

If you have problems or comments...

PBIL Back to PBIL home page