(data stored in ACNUC7421 zone)

EMBL: CP000478.PE407

CP000478.PE407       Location/Qualifiers
FT   CDS_pept        complement(496079..499339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0411"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; SMART: DEAD-like helicases-like; KEGG:
FT                   hhe:HH0797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16111"
FT                   /db_xref="GOA:A0LFA9"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA9"
FT                   /protein_id="ABK16111.1"
FT                   /translation="MVQQQCSNSKNFEEPSSSSAEHMHTDLSFITNEQHQSLRDRFEVL
FT                   IKDTSFFDCLVGYFYTSGFHALYHSLEKTEKVRILIGISTNRQTYDLLVKAGSPTQEVM
FT                   QFSHAETKEEIEKLVEDEFADSEDNRNVEAGVHKFVAWVKDKKLEIRAYPSHNIHAKLY
FT                   IMTFCEGDRDVGRVITGSSNFTQAGLIDNLEFNVELKNRSDYEYSRKKFEELWQSAVDV
FT                   GERYVQTIQQKTWLSRNITPYQLYLKLLYEYFKDELSQTDEVFIKYLPEEFKKLEYQEQ
FT                   AVLNAKKILLEYGGVFISDVVGLGKTYVSAMLAGQLSGRTLIIAPPVLLEKTNPGSWPN
FT                   VFSDFRVSADFESLGKLDDLLKRGTEKYENIIIDEAHRFRTETTATYEKLAEVCRGKRV
FT                   ILVTATPYNNAPKDILSLLKLFQKAKKSTIPNLPDLEGFFSRLEQKLKNLDRQKDYDKY
FT                   ISTVKENAREIREKVLKYLMVRRTRTEIVKYFAEDIHQQRLKFPVVERPVPLFYELNGK
FT                   EDLVFTKTVELIAQKFKYARYMPLLYYQGKVDQLEKQSQRNMGRFMKILLVKRLESSFF
FT                   AFRNSIDRFLRSYELFIKEFDNGNVYVSKKHTRKIFELLENDDDDAVQRLIDESKAERY
FT                   PSSEFAEALRQDLQHDRDVLLEIKELWTRVKRDPKLFTFLNELSTDAGLKKNHLIIFTE
FT                   SKETADYLFANLEHHYPEKVLCYTGASGEATRDKVIENFDARARHPKQDHRILVATEVL
FT                   AEGVNLHRSNTVINYDIPWNPTRMMQRVGRINRIDTPASTIHTYNFFPTTQSNDQIKLR
FT                   EAAEAKINAFLTLLGGDAELLTEGEPIGSHELFDRLLSKHTLEGDEEQGETELKYLHVI
FT                   KEIRDKHPDLFEKIKRLPRKARTAKTHAEQADSLITYFRRGKLQKFFLAADHPEAKELD
FT                   FLLAAKFMESGSEDAKRELPSQFYDLLDKNKEAFVLATTEELPQPRAKGGGRDSAANLL
FT                   KILKVTQKNTQKLTDDQELFLKKVFTQLAEGGLPKQTVKQTLKALNDLKNELINPFKVL
FT                   AVLQTHIPPKLLEGHYAEQNPSVSGKREVILSMYLSGE"
     atggttcaac agcaatgctc aaacagcaag aatttcgaag aaccttcgtc aagttcagct        60
     gagcatatgc atactgattt gtcttttatt acaaacgaac agcatcaaag tttaagagat       120
     cgatttgaag tgctcattaa agacacttct ttttttgact gcctggtggg atatttctat       180
     accagcggct tccatgcgtt gtatcactca ttggagaaaa ccgaaaaagt cagaatcctc       240
     attggtatca gcaccaaccg gcaaacctat gacttattgg tgaaagcggg cagccccacg       300
     caagaggtca tgcaattctc tcatgccgaa accaaagagg aaatcgaaaa gctcgttgag       360
     gatgagttcg cagactccga agacaaccga aacgttgaag ccggagtcca caagtttgtg       420
     gcgtgggtca aggacaagaa gttggaaatc cgggcctatc cgtcgcacaa cattcacgcc       480
     aaactctata ttatgacttt ttgcgaggga gatcgagatg ttggcagggt tatcaccggt       540
     tcgagcaact tcacccaagc cggattgatc gataacctgg agttcaatgt ggagttgaaa       600
     aaccgcagtg actatgagta ttcccgaaag aagttcgagg agttgtggca atcggcggtg       660
     gacgtcggcg agcgctatgt acagaccatc caacagaaga cttggctcag ccggaatatc       720
     acgccctatc aactctattt gaaattgctc tacgagtatt tcaaagatga gctcagtcag       780
     accgatgagg tgtttatcaa atacctgccc gaggagttca agaagctgga gtaccaggag       840
     caggccgtct tgaacgccaa gaagattttg ctggaatacg gcggggtttt catttccgat       900
     gtggtcgggt tgggcaaaac ctatgtctcg gccatgctcg ccgggcaact gtccggccga       960
     accttgatca ttgctccgcc ggtactgctc gagaaaacca atcccggttc ctggcccaat      1020
     gtgttttccg actttcgcgt gtctgctgat tttgaatcgt tgggcaagct cgacgatctc      1080
     ctcaaacggg gcaccgagaa atatgaaaac atcatcatcg atgaagccca ccgtttccgc      1140
     acggaaacca cggcgaccta tgagaaactg gcggaggtct gccggggcaa gcgggtgatc      1200
     ctggtcacag cgacaccgta caataacgcg cccaaggata tcttgagcct gctgaaactc      1260
     tttcaaaaag ccaagaaaag cacgattccc aatctacccg atcttgaagg atttttcagc      1320
     cgcctggagc agaagctcaa gaacctggat cgccagaagg actatgacaa atacatcagc      1380
     acggtcaaag agaacgcccg ggaaattcgg gaaaaggtgc tgaagtacct gatggtgcgg      1440
     cggacccgga ccgagatcgt caaatacttt gccgaggata tccaccagca gcggctgaaa      1500
     ttccccgtgg tggagagacc ggtgccgctg ttttacgagc tcaacgggaa ggaagacctg      1560
     gtctttacca agaccgttga gctcattgcc cagaagttca aatatgctcg atacatgccc      1620
     ctgctttatt atcaaggcaa ggtggaccag ctggaaaaac aatctcagcg gaacatgggc      1680
     cggtttatga agattctgct ggtcaaacgc ctggaaagca gtttctttgc cttcaggaat      1740
     tcgattgacc ggttcctccg ttcctacgag ctgttcatca aggaatttga caacggcaat      1800
     gtttacgtca gcaagaagca cacccgcaaa atctttgaac tgctggaaaa cgatgacgat      1860
     gacgccgtgc agcggctgat cgacgaaagc aaggcagagc gttatcccag cagcgaattt      1920
     gccgaagcgc tgcggcagga cctccagcat gaccgggatg tgctcttgga gatcaaggag      1980
     ctgtggaccc gggtgaaacg cgatcccaag ctcttcactt ttctcaatga attatcgacc      2040
     gacgccggac tcaaaaagaa tcatctcatc atctttaccg aatccaagga aaccgcggac      2100
     tatctgtttg ccaatttaga gcaccactat ccggaaaagg tgctgtgcta taccggcgcc      2160
     tcgggggaag ccacccggga caaggtgatt gaaaatttcg atgcccgagc ccgccatccc      2220
     aagcaagatc atcgcattct ggtagccacc gaggtattgg cggaaggcgt gaacctgcac      2280
     cgctccaata cggtgatcaa ctatgatatc ccctggaacc caacgcgcat gatgcagcgg      2340
     gtcggccgca tcaaccggat cgatacgccg gcgagcacga tccacaccta caattttttt      2400
     cccaccaccc aatccaatga ccagatcaag ctcagagagg cggcggaagc caagatcaac      2460
     gccttcttga ccctcctggg cggcgatgcg gaactgctga ccgaaggaga gccgatcggc      2520
     tcccatgagc tgttcgaccg gttgctgtcc aagcacaccc tggaaggcga tgaggagcaa      2580
     ggagagaccg agctgaagta tctccacgtt atcaaggaaa tccgcgacaa gcatccggac      2640
     ctctttgaaa agatcaagcg gctgcccagg aaggcccgca ccgccaagac tcacgccgaa      2700
     caggccgatt ccctcatcac ctattttcgc agggggaaac tgcagaagtt tttcctggcg      2760
     gcggatcatc cggaagccaa agagctggat ttcctgctgg cggctaaatt catggaaagc      2820
     ggatcggagg atgcaaagag agagctgccc agtcagtttt atgacttatt ggacaaaaac      2880
     aaggaagcgt tcgttctggc cactacggaa gaactgcctc aacccagggc caagggcgga      2940
     ggccgggaca gcgccgccaa ccttctcaag attttgaagg tgacgcagaa gaacacccaa      3000
     aagctgaccg acgatcagga actcttcctc aagaaggtct tcacacagct ggcggaaggc      3060
     gggctgccga agcagaccgt caaacaaacc ctgaaagccc tcaacgatct caagaatgaa      3120
     ttgatcaatc cgttcaaggt gctggcagtg ctccagaccc acattccccc caagctcctg      3180
     gaagggcatt atgccgaaca aaacccgtcg gtctccggta agcgggaagt cattttgtcg      3240
     atgtatttga gcggtgaata g                                                3261
//

If you have problems or comments...

PBIL Back to PBIL home page