(data stored in ACNUC7421 zone)

EMBL: CP000478.PE408

CP000478.PE408       Location/Qualifiers
FT   CDS_pept        500176..501096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0412"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: cps:CPS_4233
FT                   UbiA prenyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16112"
FT                   /db_xref="GOA:A0LFB0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB0"
FT                   /protein_id="ABK16112.1"
FT                   /translation="MGRLILWFKETRPQFLFLSVVLAFLGTAIAWYYGSFNLGYALLAG
FT                   FGLVLTHGSANAINDYFDYKSGIDLHVVRTPFSGGSGLVPDGKLPLGHALWVGVVTSVA
FT                   ALMIGVFFVIVSGWQLIPLLVAAILCLVLYTPVILRTNRPEWSPGLGLGILPIMGFYFV
FT                   QTGRYDWVVLVASVPSGILVHNLLLLNEFPDVEADRMGGRKTTPVVYGMEAAARVFRIA
FT                   TVSVYVWIVGCVLLTVATGRVVMPVYCLIALFTLPLAVKAMRGAGEYRDMSRLVPALGT
FT                   NVMFILLTQVLLGVGYILGKIFPIS"
     atgggaagac tgatactgtg gttcaaggaa acgagacccc aattcctctt tctgtcggtt        60
     gttctagcct ttcttggaac ggcgatcgcc tggtactacg ggtccttcaa cctcggatac       120
     gctcttcttg cgggtttcgg gctggtgctg acccacggca gcgccaatgc cataaacgat       180
     tatttcgatt acaagagcgg aatcgacctg cacgtcgtca ggaccccttt cagcggggga       240
     agcggactcg tccccgacgg gaaacttccg cttggacatg cgctctgggt tggcgtcgtc       300
     acgtcggtag ccgccctgat gatcggcgtt tttttcgtga tcgtgagcgg ctggcagttg       360
     ataccgctcc tggttgcggc aattctgtgc ctggtcctgt atacgcccgt gatattgaga       420
     accaaccggc ccgagtggtc gccggggctg gggctgggca tattgcccat aatgggtttc       480
     tatttcgtgc agaccggccg atacgactgg gtcgtcctgg tcgcctcggt tcccagcggt       540
     atcctggtgc acaacctgct cctgctgaac gagtttcccg atgtggaggc ggacaggatg       600
     ggcggcagga agacgacccc cgtcgtgtac ggcatggagg ccgccgcccg ggtgttcagg       660
     attgcgacgg tatccgttta tgtctggatt gtcgggtgcg tgctgttgac cgttgcaacc       720
     ggtcgagtcg tgatgccggt ctattgcctg atcgcgttgt tcactctgcc tctggccgta       780
     aaagccatgc ggggggccgg ggaatacagg gatatgagca ggctggttcc ggctctgggc       840
     acgaacgtga tgttcatcct gctgacccag gtcttgctgg gggtgggtta catcctggga       900
     aagatcttcc ccatatcgtg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page