(data stored in ACNUC7421 zone)

EMBL: CP000478.PE412

CP000478.PE412       Location/Qualifiers
FT   CDS_pept        complement(505267..505824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0416"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: gsu:GSU3293 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16116"
FT                   /db_xref="GOA:A0LFB4"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB4"
FT                   /protein_id="ABK16116.1"
FT                   /translation="MDSRVNLFCASGCRPKHDGYVEQFNKQTQEVEMSTVSCSSMDDVI
FT                   NFAISREEAAMDFYQKCADRARNPGIKKFFQEMVQEEERHRALLKDLNPMDLGTLTLDK
FT                   VEDLRISDYLVEVKFTEQVTYQEALTLAMKKEEKAHAFYEAWKNKCMHEKTAKLFEMLA
FT                   VEELKHKRKIETLYDEEILTWD"
     atggattccc gggtgaatct cttttgtgct tcggggtgtc gcccgaaaca tgacggttac        60
     gttgaacaat ttaataagca gacccaggag gtggagatga gcacggtttc ttgcagttcc       120
     atggatgacg tcatcaattt cgccatatcg cgggaagaag ccgccatgga cttttaccag       180
     aaatgcgcgg accgggccag gaaccccggc atcaagaaat tcttccagga aatggtgcag       240
     gaggaagaac gtcaccgcgc gctgctcaag gacttgaatc cgatggacct tggcacgctc       300
     acgctggaca aggtcgaaga cctgcggatc agcgactacc tggtcgaagt caagttcacg       360
     gaacaggtca cctaccagga ggcgctcacc ctggccatga aaaaggaaga gaaggcccac       420
     gccttctacg aggcctggaa gaacaagtgc atgcacgaaa agacggccaa actgttcgaa       480
     atgctcgccg tcgaggaact gaagcacaag cggaagatcg aaaccctcta cgacgaggaa       540
     atcctcacct gggattag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page