(data stored in ACNUC7421 zone)

EMBL: CP000478.PE418

CP000478.PE418       Location/Qualifiers
FT   CDS_pept        511266..513023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:C15A11.1 Hypothetical protein C15A11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16122"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFC0"
FT                   /protein_id="ABK16122.1"
FT                   /translation="MTHAARKCVVTGLALAALLLTSAFGLDPRDGWSQTVFFSQGQAPY
FT                   DPQNRQKSQQNAVREFQVQAITQAVGTFLSTSQMGTKFQAIKDKVLRQPERYVDAYQVF
FT                   SETVENGRYQVAGQVTVAMGLLKKDLIAFDIYASDDAGEDGKRDEDAVPPRAGPGEPAP
FT                   VRPGARVTDDSNGGAKAPPGGPAGDADEDGEGVTDQESDEESVGEQGGIPAGARKEPSA
FT                   RIRPGAPSDDAEANGDTVTDEPGDEQEAEDQGGPPAGAREEPSARIRPGAPAGEAEDDG
FT                   DAASDTAGGEPAREGQGGAPAGAQGKARPEAREAAPVPAGGPRGITSTSNEIFWAVSEK
FT                   WDQTWYLPGDLKDPRGLFAASVVQELLDYRYTLHFPEPGALKVDNMGNASSSQAVSQAR
FT                   MLGIRNVVVGRVVLHQRSKEPARLDAELQIIEAASGKSLGKLRKTRNLEELTNQEGAME
FT                   LAGDVTNELTGLLSGDTRAAAPAGPVPVAGEGEWVLRLQAADHHAYWREVEKLLREQAR
FT                   GMTMLGMEMGPQETVIRLGGIDGRTLSSLDGRVLSGGVTIKIDDLSPDTRTTRVLFVRQ
FT                   AVPQPGPKP"
     atgacacatg ccgcaagaaa atgcgttgtg acgggattgg cgctggccgc gcttttgttg        60
     acctccgcct ttgggctcga ccctcgcgac ggatggagtc agaccgtgtt tttcagccag       120
     gggcaggcgc cctacgatcc ccagaatcgg caaaaaagtc agcagaatgc cgttcgtgaa       180
     tttcaggtgc aggccatcac gcaggccgtg ggtacattcc tgagcacgtc acagatgggg       240
     accaagtttc aggccatcaa ggacaaagtg cttcgccagc cggaacgata cgtggatgca       300
     taccaggtct tttccgaaac cgtcgagaac ggcaggtatc aggttgcggg gcaggttacg       360
     gtggcaatgg ggctgttgaa aaaagacctc atcgctttcg acatctacgc gtccgacgat       420
     gcgggggagg atgggaaaag agatgaagac gcggttcctc cccgcgcagg ccccggggag       480
     cccgcacccg tccggcccgg agcccgggtg acggacgatt cgaacggcgg ggccaaggcc       540
     ccgcccggag gcccggcggg ggatgcggat gaggacggcg agggggtcac cgaccaggag       600
     agtgatgagg agagtgtcgg ggaacaaggc ggaattccgg cgggagcccg gaaggaacct       660
     tcggcgagga tccgccccgg agccccttcg gatgacgcgg aagcaaacgg cgatacggtg       720
     acggacgaac cgggcgatga gcaggaggcc gaggaccagg gtggacctcc ggcgggagct       780
     cgggaggaac cttcggcgag gatccgcccc ggagcccccg cgggggaagc ggaagacgat       840
     ggcgatgcgg cttccgacac ggccggcggt gaacctgccc gtgaaggaca gggtggagct       900
     ccggccggag cgcagggcaa ggcgcggcct gaggctcgag aagcggcccc ggtcccggcc       960
     ggcggcccac gcggaataac ctcgacttcc aacgagatat tctgggcggt ctcggaaaaa      1020
     tgggaccaga cctggtacct gcccggagac ctgaaagacc cccgggggct ctttgcggcg      1080
     agtgttgtcc aggaactgct ggactaccgc tacaccctgc actttccgga acccggagcc      1140
     ctcaaagtcg acaacatggg gaacgcctct tcgagccagg cggtatccca ggccaggatg      1200
     ctgggaatcc ggaacgtggt ggtgggccgg gtggtgttgc accagcggag caaggaaccc      1260
     gcgcgtctcg atgccgagct tcaaatcatc gaagcggcgt cgggcaagtc cctggggaag      1320
     ctccgcaaaa cccggaacct cgaagagttg accaaccagg aaggagccat ggagcttgcc      1380
     ggggatgtca cgaatgagct gacggggttg ctgtccgggg acactcgcgc cgcggctccg      1440
     gccggcccgg tgcccgtggc cggcgagggg gaatgggtgc tgaggctcca ggcggcggac      1500
     catcacgcgt attggaggga ggtggagaag ctgctccggg agcaggcgcg ggggatgacc      1560
     atgctcggaa tggaaatggg gccccaggag accgtgatcc ggctcggcgg aatcgacggc      1620
     cgcacgcttt cctcactcga cgggagggtg ctctccggcg gggtcacgat caaaatcgat      1680
     gacttgtcgc ccgacacgcg gacgacacga gtgttgttcg ttcggcaggc agtgccgcaa      1740
     cccgggccga aaccatga                                                    1758
//

If you have problems or comments...

PBIL Back to PBIL home page