(data stored in ACNUC7421 zone)

EMBL: CP000478.PE420

CP000478.PE420       Location/Qualifiers
FT   CDS_pept        514085..516019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0424"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein; Threonyl/alanyl tRNA synthetase, SAD; KEGG:
FT                   gme:Gmet_1411 threonyl-tRNA synthetase, class IIa"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16124"
FT                   /db_xref="GOA:A0LFC2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFC2"
FT                   /protein_id="ABK16124.1"
FT                   /translation="MSAEISVTLADGTTKSFPRGVSAGEVLKASGGPNGWVAAKVNGVP
FT                   VDLIVGIEEDAAVEGIRADSEVGLEILRHSAAHVMAQAVKSLFPEARVAIGPAIDNGFY
FT                   YDFEVERPFTQDDLDRIEAKMKELVGAKLKFERKVLPRDEAIDFFTRRGEGYKVELLQG
FT                   FSDPTVSFYTQGDFVDLCRGPHVPHSGYVRAFKLTSVAGAYWRGDEHNAMLQRIYGTAF
FT                   ADRDALKKYLHFLEEAQKRDHRRLGRELDLFSFSDEVGAGMVIYHPRGALLRHILEAFE
FT                   KREHLRRGYHIVMGPTLLKTELWKRSGHFEHYRENMYFTEIEEQSYGIKPMNCLAHMLI
FT                   YKSRLRSYRDLPLRYFELGTVHRHERSGVLHGLTRVRQFTQDDAHILCTPEQLHGEIQS
FT                   IIDFVIEVMGIFGFNHEMEISTRPAKSIGSDEDWERATSALIDALEDKGIPYQVCEGEG
FT                   AFYGPKIDVKLRDALDRKWQCATIQCDFTLPDRFDLTYVGVDGNRHRPVMVHRVVLGSL
FT                   ERFIGVLVEHFAGAFPTWLAPVQAIVVTVTDGQIEFARNMYDRLREAGVRVELDDRNEK
FT                   LGYKIREAQMQKVPYMLVIGDREVAAGGVAPRRRDGTQLELIAPEAFAAMIQKECLEAT
FT                   KGRVGLGIV"
     atgagcgcag agataagtgt aacgctggca gacggtacaa cgaaatcctt tcccaggggc        60
     gtttccgccg gtgaggtcct gaaagcttcc ggagggccga acggttgggt ggcggccaag       120
     gtcaacggtg tgcccgtgga cctgatcgtc gggatcgagg aagacgccgc cgttgaagga       180
     atacgggccg attccgaggt ggggctcgag attcttcggc acagtgccgc ccacgtcatg       240
     gcccaggccg tcaagtcgct gttccccgaa gccagggtgg ccatcgggcc ggccatcgac       300
     aacgggttct attacgattt cgaggtggaa cggccgttca cgcaggacga tctggacagg       360
     atcgaggcga agatgaagga gctcgtcggg gcgaaattga aattcgaacg gaaagtgctg       420
     cctcgcgacg aagccatcga cttcttcacg cgccggggag aaggatacaa ggtcgagctg       480
     ttgcagggat tttcggatcc gacggtctct ttttacacgc agggcgattt cgtggatctg       540
     tgccgcggac ctcatgtgcc ccacagcggg tacgtcaggg cgttcaagct gaccagcgtg       600
     gccggggcct actggcgggg cgacgagcac aacgccatgc tgcagaggat ttacggcacg       660
     gcgtttgccg atcgcgacgc gctcaagaaa tacctgcact ttctggaaga agctcaaaag       720
     cgggaccacc ggcgtctggg ccgggagttg gatctcttca gcttcagcga cgaggtcggc       780
     gcgggaatgg tcatctacca tcccagggga gcgttgctgc ggcacatcct ggaggccttc       840
     gaaaaacggg agcacctgcg cagggggtat catatcgtta tggggccgac cctgctcaag       900
     acggagctgt ggaaacggtc gggccatttc gagcactacc gggagaacat gtacttcacc       960
     gagatcgagg agcagtccta cggcatcaag cccatgaact gccttgccca tatgcttatc      1020
     tacaagtccc ggctgcgaag ctaccgggat ctgcctctgc gctatttcga gctcggcacc      1080
     gtgcaccgcc atgagcggtc gggcgtgctg cacggtctga cgcgcgtaag gcagtttaca      1140
     caggacgacg cgcatatcct ctgcacgccg gagcagttgc acggtgaaat tcaaagcatt      1200
     atcgactttg tgattgaggt gatgggcatt ttcgggttta atcatgaaat ggaaatcagc      1260
     acccgcccgg caaaatccat cggttcggat gaagactggg aacgcgccac gagcgccctt      1320
     atcgacgcct tggaagacaa ggggattccg taccaggtgt gcgaaggcga aggggcgttc      1380
     tacgggccca agattgacgt aaaattgaga gatgcgttgg atcgcaaatg gcaatgcgcc      1440
     acgatccagt gcgatttcac gttgccggac agattcgacc tcacgtatgt cggcgtcgat      1500
     gggaaccggc accggccggt gatggtgcat cgtgtggttt tggggtccct ggagcggttc      1560
     ataggggtcc tggtcgagca ttttgcggga gcgtttccga cgtggctcgc ccccgttcag      1620
     gccattgtgg tgaccgtgac cgacgggcag atcgaattcg cccgcaacat gtacgaccgg      1680
     ctgcgggaag cgggtgtgcg cgtcgaactg gacgaccgca acgagaagct cggttacaag      1740
     attcgcgagg cgcaaatgca gaaggtccca tacatgctgg tgatcggaga ccgggaggtt      1800
     gccgcgggcg gcgtagcgcc gcgccggcgc gatgggactc aactggaact gattgccccc      1860
     gaagcctttg cggcgatgat ccagaaggaa tgtctggagg ccaccaaggg acgggtgggg      1920
     ctgggaatcg tatag                                                       1935
//

If you have problems or comments...

PBIL Back to PBIL home page