(data stored in ACNUC7421 zone)

EMBL: CP000478.PE423

CP000478.PE423       Location/Qualifiers
FT   CDS_pept        517092..517445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0427"
FT                   /product="LSU ribosomal protein L20P"
FT                   /note="TIGRFAM: ribosomal protein L20; KEGG: gme:Gmet_1414
FT                   50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16127"
FT                   /db_xref="GOA:A0LFC5"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFC5"
FT                   /protein_id="ABK16127.1"
FT                   /translation="MPRVKKAVKSRERRKKILKLAKGYRGGRGKLIRSASETVDRALKF
FT                   AYRDRKTRKRQFRSLWIMRINAAAREHDLSYSRFMHALKKANIDMDRKALAHLAVNDPA
FT                   AFAKLARIAKEAA"
     atgcctagag taaagaaagc tgttaaatcg cgcgagcgcc gcaagaaaat cctgaagttg        60
     gcgaaaggct atcgtggcgg ccgcgggaag ctgattcgca gtgcttccga aacggtggat       120
     cgtgccctca agtttgccta ccgcgaccgc aagacccgta aacgccagtt ccgaagcctg       180
     tggatcatgc gcatcaatgc cgccgcccgc gagcatgacc tgagctattc gaggttcatg       240
     catgccctga agaaggcaaa catcgacatg gaccgcaagg cattggccca tcttgccgtg       300
     aacgaccctg cagcattcgc caaactggcc cggatcgcca aagaagccgc ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page