(data stored in ACNUC7421 zone)

EMBL: CP000478.PE425

CP000478.PE425       Location/Qualifiers
FT   CDS_pept        518756..521158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0429"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: sat:SYN_01723 phenylalanyl-tRNA synthetase beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16129"
FT                   /db_xref="GOA:A0LFC7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFC7"
FT                   /protein_id="ABK16129.1"
FT                   /translation="MIVSLKWLRDYVETSLSVEELTHRLTMVGLEIDGCHPLHPCLGRV
FT                   VTARVEKVEPHPRADRLSVCEVSDGHGRYSVVCGAPNVKAGQIVPLALPGAELASGVKI
FT                   GQATIRGVASLGMLCSQKELGLGEDASGIWPLPGEVPVGVPLSEALDLDDTILDVAVTP
FT                   NRGDCLSIVGIAREIAAISGVRLRYPAVACRETGPEVDSLASVRIDAPDGCPRYAARVI
FT                   EGITVGPSPQWLKDRLEAVGLRSINNIVDVTNYILMELGQPLHAFDFDLLREQRIVVRY
FT                   AREGERFTTLDGTERILFGDTLMICDGVGPVAVAGIMGGLDSEIGARTRRVLIESACFE
FT                   PRCIRRSSRKLGLRTESSYRFERGVDPEGVIRALDRAAQLMVEVGGGDLATGRVDAYPR
FT                   PAEKPVLVLRTDRVNRFLGTDLTPAEMAGALRSIEMQVEENGGGLEVIPPTFRPDITRE
FT                   VDLAEEIARLAGYDRVPVTYPEVRMEAASLDRHLQARMDIKGYLEGAGFFEAINYSFVS
FT                   MESLRKLKFPAGDRRLNPVQIRNPLSEEQAVMRTTLVPSLLQTARYNFDHKNDDLKLFE
FT                   LSKVFLPVEGAPLPEEVHEVAGILAGKRSLNLLYGGDDDVDYADAKGIVEGILELLHIE
FT                   GVRFDSEAPPPYLDAACAATIMHGELNLGAVGRVAADVRAAFDLKKPVFVFDLDFERLF
FT                   GIARPPAFFSSLPKFPSVSRDMALVVDESVPVQGPFDFIRSQGEALLEHIDIFDIYRDP
FT                   QLGAGRKSIGYRLVYRAADRSLTDEEVNRLHEGLVSKVLVEFDARLR"
     atgattgtca gcttgaagtg gctccgggat tatgttgaga cctcgctttc cgtcgaggaa        60
     ctgacgcatc gactgacgat ggtggggctc gaaatcgacg gctgtcatcc cttgcatcca       120
     tgcctgggca gggtggtgac ggcacgggtg gaaaaggttg agccgcaccc ccgggcggat       180
     cgtctgagcg tctgcgaggt ttccgacggg cacggacggt actccgtcgt gtgcggcgcg       240
     cccaatgtga aggcggggca gatcgttccg ctggcgcttc ccggcgccga actggcaagt       300
     ggtgtcaaaa tcgggcaggc aacgattcga ggggtggcct cgctgggcat gctctgttcg       360
     cagaaggaac tgggactggg cgaagacgcc tcgggaatct ggcctctgcc gggcgaggtg       420
     cctgtggggg tgcccttgtc cgaagccctg gatctagacg acacgatcct cgacgtcgcg       480
     gtgaccccca accgcggcga ctgcctgtcc atcgtcggca ttgcccgcga gatcgcggcc       540
     atttccggcg tgcggttgcg atatccggcc gttgcgtgcc gggaaaccgg gccggaggtc       600
     gattcccttg cctcggttcg gatcgatgct ccggatggat gcccgcgata tgccgcgcgc       660
     gttatcgaag gaatcaccgt cgggccttct ccgcaatggc tcaaggacag gctggaagcc       720
     gtcggattgc ggtccataaa caatatcgtg gatgtgacga actacatcct gatggaattg       780
     gggcaaccgc tgcatgcgtt cgacttcgac cttttgcgcg agcaacggat cgtcgtgcgt       840
     tatgcccgcg agggcgaacg attcaccacg ctggatggaa ccgagagaat cttgttcggg       900
     gataccctga tgatctgtga cggtgtggga ccggttgccg tggcggggat aatgggagga       960
     ctcgattcgg aaatcggcgc gcggacgagg cgcgtgctca tcgagagcgc ctgcttcgaa      1020
     ccaaggtgca tacggcgcag cagtcgcaag ctcggcttgc gaacggagtc gagctaccgt      1080
     ttcgagcggg gtgtggaccc ggagggtgtg atccgcgccc tggaccgggc tgctcaactg      1140
     atggtggaag tcggcggcgg agacctcgcg acgggaaggg tcgacgcgta tcctcgcccc      1200
     gccgagaaac cggtgctggt cctgaggacg gaccgggtga atcgttttct gggaacggac      1260
     ctcacccccg cggaaatggc cggggcgctc cgctccatcg agatgcaggt cgaggagaac      1320
     ggcggcggcc tcgaggtgat cccgccgact ttccggcccg acatcacgcg cgaagtcgat      1380
     cttgctgagg aaatcgccag gttggccgga tacgaccggg tgcccgtgac ctaccccgag      1440
     gtgcgaatgg aagccgcttc gctggatcgg catctgcagg cgcggatgga catcaagggc      1500
     tatctcgagg gcgcggggtt ctttgaggcc atcaactact cgttcgtttc gatggaatcc      1560
     cttcggaaat tgaaattccc ggcgggcgac aggcgcctga atcccgttca gatcaggaac      1620
     ccgctcagcg aggagcaggc ggtgatgcgc accacgctgg tgccgagcct gctgcaaacg      1680
     gcccggtaca acttcgatca caagaacgac gatctgaagc tgttcgaatt gagcaaggtg      1740
     tttctgcccg tcgagggggc cccgctcccc gaggaggtcc acgaggtggc cgggattctg      1800
     gccggaaagc gttccctgaa cctgctctac ggcggcgatg acgacgtgga ttatgccgac      1860
     gccaagggca tcgtggaagg gatcctggaa ctcttgcaca tcgagggcgt tcgatttgac      1920
     tccgaagctc cgcctcctta tctggacgcg gcatgcgccg ccacgatcat gcacggggaa      1980
     ctgaacctcg gagccgtggg aagggtggcc gccgacgtcc gggccgcctt cgacctgaag      2040
     aaacccgtgt tcgtgttcga tctcgatttc gagagactgt tcggaatcgc gcggccgccc      2100
     gcctttttca gcagtttgcc gaaattcccg tcggtttcgc gggacatggc gctcgtcgtg      2160
     gacgagagcg ttcccgtgca ggggccgttc gatttcatcc ggagtcaggg tgaagcgctc      2220
     ttggaacaca tcgatatatt cgatatatat agagacccgc aattgggggc cggaagaaag      2280
     agcatcgggt acaggctggt ttaccgggct gccgaccgca gtttgaccga cgaggaagtg      2340
     aaccgcctcc atgaaggttt ggtgagcaag gttctggtgg agttcgacgc caggttgaga      2400
     tga                                                                    2403
//

If you have problems or comments...

PBIL Back to PBIL home page