(data stored in ACNUC7421 zone)

EMBL: CP000478.PE428

CP000478.PE428       Location/Qualifiers
FT   CDS_pept        522328..525357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0432"
FT                   /product="Phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: gme:Gmet_1941
FT                   phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16132"
FT                   /db_xref="GOA:A0LFD0"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD0"
FT                   /protein_id="ABK16132.1"
FT                   /translation="MATRLEISLKEHLFDAEGAGLCRKIKDYFGWDVQRARVIHILTLD
FT                   TGLTGVELEAVRKEIFTNPVTQVSVYGTSAVRFDWAIWVGYRPGVRDTAGSVAVEAISD
FT                   LLGRKLGAEESAYTSRLYLLSGTRLGKTEVETVARELLANDIVQQWRIYRYDEWDPAGG
FT                   VGIILPRVVLPHTPETREMPIESPEDLMRLSDERNLALNPLDVPVILDYFARPEVVRAR
FT                   REMGLGAPTDVELEAISQARSDHCNHNTFRGKFHYRDLATGERTVVDNLFKTCIEAPTL
FT                   AIQAEKDWVVSVLWDNAGVARFDDNNNYVITGETHNSPSNMEAYGGALTGIVGIYRDIM
FT                   GTGKGARLTAGLYGYCVGPKDYRGPLRPHLHPRRLLDGIVEGVKDGGNKHGVPTPFGNL
FT                   FFHPSFLGKCLVFVAALGIMPRLVRGEPSDLKRPDPGDFIIMSGGRVGKDGIHGVTASS
FT                   EIYSESTPAGHVQIGDPYTQKKMHDFLLEARDEGLISFITDNGGGGLSSSVGESARFCG
FT                   GARVELDKVPLKYEGLDQWEIWVSESQERMTVAVNPRHLDRFMELSRRHEVESTAIGTY
FT                   GSDGRLHLTYRGKTCACLDLSLFTEAFPQWEFEADWQPPDNRGLHEPVLAEPADYGRLL
FT                   HDVLARPNVCSREWIQRQYDHEVQGGSVIKLMTGVDRDVPNDAAVLRPALESRRGLAVS
FT                   QSINPTYSAIDTYHMVAATIDEAVRRLVAVGGRLEEIGGVDNFCWPSVQYDPVSNPDGR
FT                   YKAAQLVRANWALRDICLAFGIPLLSGKDSMYVDGHLGGAYGERHKISGLPTMQFTATT
FT                   VVPDISDCQTMDVKTAGDLVYVLGWTHDELGGSEYYDCFGYLGRNVPELDPESVLPVYR
FT                   VVEKAIREGLVASCHGIYRGGLGVHAAMAAMAGGLGMRLDLEKVPVAHAGAQAKSGPGP
FT                   RDDHILFSESCGRFILTVSPAMRGAFEAMAGGLPCAPVGEVLAEPVFVVAGRSGNVLLE
FT                   EPVGELKHSWKFGAGGERGE"
     atggcgacac gacttgagat atcgctcaaa gaacatctgt ttgacgccga aggggccggc        60
     ctgtgccgaa agatcaagga ctacttcggc tgggatgtcc aacgggcccg tgtcattcat       120
     atcttgacac tcgacacggg gcttaccggg gttgagctcg aggccgtccg caaggagata       180
     ttcaccaacc cggtgacaca ggtgtcggtg tacggaacgt cggcggttcg gttcgactgg       240
     gcgatctggg tggggtaccg ccccggcgtg agggataccg cgggcagtgt ggctgtcgag       300
     gccatctccg atctgctcgg ccggaagctg ggcgcggaag agtccgccta cacgtccagg       360
     ctctacctcc tttcggggac ccgcctcggt aaaacggaag tcgaaaccgt tgcgcgtgag       420
     ttgcttgcca acgacatcgt ccagcagtgg cgcatatacc gttacgacga atgggatccc       480
     gccgggggag tcgggatcat tctgcccagg gtggtgcttc cgcacactcc cgaaacccgg       540
     gagatgccca tcgaatcccc ggaagacctg atgcgattga gcgacgagcg caacctggcg       600
     ctcaatcccc tcgacgttcc ggtgatcctc gactacttcg ctcgtccgga ggtcgtccgg       660
     gcgcgccgcg aaatgggcct gggggcgccc acggacgtcg agctcgaagc gatttcgcaa       720
     gcccgcagcg accactgcaa tcacaacacg tttcggggga agttccacta ccgggatctt       780
     gcgaccggcg agcgcacggt cgtggacaac ctcttcaaga cctgtatcga agcccccacg       840
     cttgccatcc aggcggagaa ggactgggtg gtatcggtcc tctgggacaa cgccggcgtt       900
     gcccgcttcg acgacaacaa caactacgtc atcaccggcg aaacccacaa cagcccatcc       960
     aacatggaag cctacggcgg agcgctcacg ggcattgtgg ggatttaccg ggacatcatg      1020
     ggaacgggca agggagcgag gctgacggcc ggcctctacg ggtactgcgt ggggcccaag      1080
     gattaccggg gtccgttgcg gccgcacctg cacccccgac ggctgctcga cggcatcgtg      1140
     gaaggggtga aggacggagg aaacaagcac ggggttccga cgcctttcgg aaacctgttc      1200
     ttccacccgt cttttctcgg caagtgcctg gtgttcgtgg ccgccctggg catcatgccg      1260
     cggctggtcc ggggggaacc ttcggatctc aagcgcccgg acccgggaga tttcatcatc      1320
     atgagcggcg gtcgcgtggg caaggacggt atccacggag tcacggcatc cagcgagatc      1380
     tacagtgaaa gcacccccgc gggtcatgtt cagatcggcg acccctatac ccagaagaag      1440
     atgcacgatt ttctgctgga agcgcgcgac gaggggctca tttcattcat cacggacaac      1500
     ggcggcggcg gtctttcctc ctcggtcggg gaatcggcgc ggttttgcgg gggcgcccgc      1560
     gtcgagctgg acaaggttcc cctgaagtac gaaggcctcg atcagtggga gatctgggta      1620
     tcggaatccc aggaacggat gaccgtggcg gtcaatcccc ggcatctcga ccggttcatg      1680
     gaactgtcgc gcaggcacga agtggaaagc acggccatcg gcacatacgg ctccgacggc      1740
     aggctgcacc tgacgtaccg ggggaagacc tgcgcgtgcc tcgacctgag tctcttcacg      1800
     gaagcgttcc cgcaatggga attcgaagcc gactggcaac ctccggacaa ccgcggactg      1860
     catgagccgg tgcttgcgga accggcggat tacgggcggt tgctgcacga tgtcctggcc      1920
     cgccccaacg tgtgctcccg ggaatggatc cagcggcagt acgaccacga agtgcagggg      1980
     ggcagcgtca tcaagctgat gaccggcgtg gaccgtgacg tgcccaacga tgcggccgtc      2040
     cttcgccccg ccctggaaag caggcggggg ctggcggttt cccagtcgat caatccgacc      2100
     tattccgcca tcgacaccta ccacatggtt gccgcgacca tcgatgaagc ggtgcggcgg      2160
     ctggtggccg tcggggggag acttgaggag atcggagggg tcgacaattt ctgctggccg      2220
     agcgttcaat acgaccccgt gagcaatccg gacggcaggt acaaggccgc tcaactcgtg      2280
     cgggcaaact gggcgcttcg agacatctgc cttgctttcg gcattccgct gctctcgggc      2340
     aaggacagca tgtacgtgga cgggcatctt ggcggggctt acggggaacg gcacaagata      2400
     tcggggctgc cgacgatgca gtttacggcg accaccgtcg tgcccgacat ctccgattgt      2460
     cagaccatgg acgtcaagac cgccggggat ctcgtctatg tgctcggctg gacccacgac      2520
     gagctgggag gttccgagta ttacgattgc ttcggatacc tcgggcggaa cgttcccgag      2580
     ctcgatcccg aatcggtgct gcccgtctat cgggtggtgg aaaaggccat aagggagggg      2640
     ctggtcgcct cctgccacgg catctaccgg ggcgggctgg gagtccacgc agccatggcc      2700
     gcgatggcgg ggggactcgg aatgaggctc gacctggaga aagtgccggt tgcgcatgcg      2760
     ggcgcgcagg cgaaaagcgg tcccggaccg cgcgacgatc atatcctgtt cagcgagtcg      2820
     tgcgggcgct tcatcctcac tgtttcaccc gccatgcgcg gcgccttcga agccatggcg      2880
     ggcgggctgc cgtgcgctcc ggtcggggag gtcctggccg aaccggtgtt tgtcgtcgcc      2940
     gggaggagtg gaaacgtgct gttggaggaa cccgtgggag aactgaagca ctcatggaaa      3000
     ttcggagcgg gcggggaaag aggcgaatga                                       3030
//

If you have problems or comments...

PBIL Back to PBIL home page